TFome Information for pUT6075

TFome Name:pUT6075
Genbank Insert ID:KJ727963
Protein Name:ZmARF34
Species: Maize
TF Family: ARF
Template: RT-PCR
Corresponding TF Gene: GRMZM2G081158
Transcript: T01
Vector: pENTR/SD/D-TOPO
Note: c.A1288T p.N430Y. Not in functional domain.

5' Primer Name: R4-F 3' Primer Name: R4-R
5' Primer Sequence: caccATGAACCTCTCCCCGCCCAAG 3' Primer Sequence: GTAGTCCAGAGGCACCACAGGCG
5' Primer Tm (º C): 65.34 3' Primer Tm (º C): 63.7
PCR Condition:
Nucleotide Sequence: ATGAACCTCTCCCCGCCCAAGATGTCGGAGCCATCACCTGAAAGTGACGGGGAACAAAGGTGTCTGAACTCAGAGCTATG
GCATGCATGCGCAGGGCCCCTTGTGTCCCTGCCTGTGGTTGGGAGCCGGGTCGTCTACTTTCCTCAGGGCCATAGTGAGC
AGGTTGCTGCATCAACTAATAAAGAAGTTGATGCTCAAATCCCAAACTATCCAAACCTACCTCCACAGTTAATATGCCAG
CTTCATAATGTCACAATGCATGCTGATGCAGAGACTGAAGAGGTGTATGCCCAAATGACACTGCAACCATTGAGCCCGGA
AGAGCAAAAGGATCCTTTTCTTCCAATTGAATTGGGTGCTGGTAGCAAGCAGCCAACCAATTACTTCTGCAAGACGTTGA
CTGCAAGTGATACGAGTACCCATGGTGGATTCTCTGTTCCGCGCCGAGCAGCTGAGAAAGTCTTCCCTCCATTGGATTTT
TCACAACAGCCTCCAGTGCAAGAGCTGGTTGCAAGAGATCTGCATGATAATGAATGGAAATTTCGTCATATTTTTCGTGG
TCAGCCAAAAAGGCATCTACTGACGACTGGTTGGAGTGTTTTTGTAAGCGCGAAAAGACTAGTAGCAGGGGATTCTATCA
TATTTATCTGGAATGATAATAACCAGCTTCTCTTGGGAATTCGCCGTGCAAGTCGTCCACAGACTGTAATGCCCTCTTCT
GTGCTATCAAGCGATAGCATGCACATTGGTCTTCTTGCTGCAGCAGCTCATGCTGCAGCCACAAACAGTCGTTTCACTAT
TTTCTACAACCCTCGGGCTAGCCCTTCTGAGTTTGTCATTCCACTGGCTAAGTATGTGAAAGCTGTTTACCACACGCGCG
TATCTGTTGGAATGCGGTTTCGGATGCTTTTTGAGACAGAGGAATCAAGTGTCAGAAGATACATGGGTACAATCACAGGC
ATAAGTGATCTGGACTCAGAGCGCTGGCCAAACTCGCACTGGCGTTCTGTGAAGGTTGGTTGGGATGAGTCTACAGCTGG
TGATAAACAGCCAAGAGTTTCACTCTGGGAGATTGAGCCACTGACAACCTTTCCGATGTACCCAACTGCTTTTCCATTAA
GGCTAAAGCGTCCGTGGGCTTCAGGACTACCTATGTTCAATGGTGGGAGGAGCGACGAGTTCGCTCGTTATTCTTCTCTC
ATGTGGCTTCGAGATGGAAACCGAGGGGCTCAGTCACTGAACTTCCAGGGACTTGGAGCATCACCATGGCTTCAGCCAAG
AATAGATTATCCATTGTTGAGTCTGAAGCCAGATACTTACCAGCAGATGGCTGCCGCCGCACTAGAAGAAATTAGAGCTG
GGGATCATTTGAAGCAGGCATCTTCTCTCCTGCCAGTTCAGCAGACTCAAACTTTGAATGGTGGATTAGATCATTTGTAT
GGAAATCCTGTTCTACAGCAGATGCAGTTCCAATCTCAGCAGTCAACACTGCAAGCTGTGCAGCAAGGTTATGGTCAGAA
TGCAAACGACTCTGGGTATGTTCAAAATCAACTGCAGCAGCTGCAGCTGCAAAAGCAGCAGGAGCCACCACCACCACAGC
AGCAGCAGCAGACACAAGTCCTTCAGCGACAAGCACATCAGGAAATGCAACAGCACCTCTCAGCTAGTTGTCATGATATT
GCTAATGTAGCTTCTGGTGTGTCCATGTCTGGATCTGCTTGTCAATCACAATCTTCTCTGCTTTCTGGGTCATCGTTCTA
CCAACAGAACATCTTTGATGGAAATGGTGGTCCAGATCTGCATCTGCACAACAGTTTCCACAACTTTTCAAGCCAAGAGT
CCTCCAACCTTCTTAACCTCCCAAGAAGTGGCCAATTAATGGCATCAGAGGGATGGCCTTCAAAGAGGTTGGCTGTGGAA
TCTCTTGCTGGTCATGAGATCCAACCTCTGCAGCACAAGCTTGAGAAAGTTAGTCACCAGAGTACTGTGTCTCACTGTTC
TGGCACCTTGCCGCCACTATCAGCAAGAGACGGTTCTAGTGCCCAGGCTTGTGGTACAAATGTTCAGAGTCACCTGCTTC
CATCATCATTTGCAATCCATGATGGATTGTCAACCATCAGGAGTGGTGGTGTTGGCAGTGGAACTGATGCGATAACCATA
GCTTCGTTGAGATATAGTGATGCGAATTTGCTACCTGAAAACTCCATAGCAACTTCCAGTTGTTTGGGTGAATCAGGAAC
CTTCAATTCTCTTGACGATGTTTGTGGTGTAAACCCATCACAAGGTGGAACCTTTGTGAAGGTTTACAAATCAGGGTCCC
TCGGGAGATCGCTCGACATCACCAGATTCGGCAGCTACTACGAGTTGCGTGTCGAGCTCGAGCGGTTATTTGGTCTCGAA
GGCCAACTGGAGGACCCTGCAAGATCAGGCTGGCAGCTTGTATTCGTCGACCGGGAAAACGATGTTCTTCTCCTCGGCGA
CGACCCGTGGCAGGAGTTTGTGAATAGCGTAGGGTGCATAAAGATCCTCTCGCCGCAAGACCTGCAGCAGATGGCCCGCG
GCGGCGGAGGTGACCTTCTGTCTGCGCCTGGAGCGAGGATGCTGCAGGGCAGTGTCTGTGACGACTATTCTGCAGGCCAC
GACGTGCAGAACCTCACCGGCAGCATTGCGCCTGTGGTGCCTCTGGACTAC
TFome clones do not contain stop codon at 3'end.
Translation: MNLSPPKMSEPSPESDGEQRCLNSELWHACAGPLVSLPVVGSRVVYFPQGHSEQVAASTNKEVDAQIPNYPNLPPQLICQ
LHNVTMHADAETEEVYAQMTLQPLSPEEQKDPFLPIELGAGSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDF
SQQPPVQELVARDLHDNEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSIIFIWNDNNQLLLGIRRASRPQTVMPSS
VLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETEESSVRRYMGTITG
ISDLDSERWPNSHWRSVKVGWDESTAGDKQPRVSLWEIEPLTTFPMYPTAFPLRLKRPWASGLPMFNGGRSDEFARYSSL
MWLRDGNRGAQSLNFQGLGASPWLQPRIDYPLLSLKPDTYQQMAAAALEEIRAGDHLKQASSLLPVQQTQTLNGGLDHLY
GNPVLQQMQFQSQQSTLQAVQQGYGQNANDSGYVQNQLQQLQLQKQQEPPPPQQQQQTQVLQRQAHQEMQQHLSASCHDI
ANVASGVSMSGSACQSQSSLLSGSSFYQQNIFDGNGGPDLHLHNSFHNFSSQESSNLLNLPRSGQLMASEGWPSKRLAVE
SLAGHEIQPLQHKLEKVSHQSTVSHCSGTLPPLSARDGSSAQACGTNVQSHLLPSSFAIHDGLSTIRSGGVGSGTDAITI
ASLRYSDANLLPENSIATSSCLGESGTFNSLDDVCGVNPSQGGTFVKVYKSGSLGRSLDITRFGSYYELRVELERLFGLE
GQLEDPARSGWQLVFVDRENDVLLLGDDPWQEFVNSVGCIKILSPQDLQQMARGGGGDLLSAPGARMLQGSVCDDYSAGH
DVQNLTGSIAPVVPLDY
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map