TFome Information for pUT6076

TFome Name:pUT6076
Genbank Insert ID:KJ727964
Protein Name:ZmARF1
Species: Maize
TF Family: ARF
Template: RT-PCR
Corresponding TF Gene: GRMZM2G169820
Transcript: T01
Vector: pENTR/SD/D-TOPO
Note: c.C2092T p.L698F conserved SNP. Not present in functional domain.

5' Primer Name: R7-F 3' Primer Name: R7-R
5' Primer Sequence: caccATGGAGGCGCCGGGGACGAG 3' Primer Sequence: GTCGCCGGTGACCCTCCACG
5' Primer Tm (º C): 69.75 3' Primer Tm (º C): 65.37
PCR Condition:
Nucleotide Sequence: ATGGAGGCGCCGGGGACGAGCTCGGGCGGCGCCGGAGGCGAGGGGGCCGGGGGCACCAAGGTCAACGAGGAGCTGTGGTA
CGCGTGCGCGGGACCGCTCGTGGCGCTGCCGCCGGCGGGGAGCCTCGTTGTCTACTTCCCGCAGGGACACAGCGAGCAGG
TAGCAGCATCTATGCGAAAGGATGCAGATGCCAAAATTCCGAGCTATCCAAATCTCTCATCTAAGCTTATATGCATACTC
CGTAGTGTCACTATGCTTGCTGATCCTGACACAGATGAGGTTTACGCTCGAATGACTCTCCAGCCCGTTAGCAATGTGAC
GCATTGTGACAAGGAGACGTTGCTGGCAACAGAGCTTGCACTGAAACAAACCAGACCACAGACAGAGTTCTTTTGTAAAA
CACTGACTGCAAGTGATACAAGCACTCATGGAGGTTTCTCTGTGCCACGGCGTGCTGCAGAGCGAATTTTCCCCCATCTT
GACTTCTCAGTGCAGCCTCCTGCTCAGGAACTGCAGGCCAGGGATTTGCACGATGCAATTTGGACATTCCGTCATATATA
TCGAGGCCAGCCTAAAAGGCATTTGCTGACTACTGGCTGGAGCCTATTTGTCAGTGGAAAGAGACTCCTTGCTGGTGATT
CAGTCCTGTTTATTAGGGACGGAAGACAGCAACTCCTCTTGGGGATAAGGCGAGCAAATAGGCAGCCCGTTAACCTCTCA
TCATCTGTTTTGTCTAGCGACAGTATGCATATTGGAATTCTTGCTGCTGCAGCCCATGCAGCAGCCAATAACAGCCAATT
CACAGTATTCTATAACCCAAGGGCTAGTCCTTCAGAATTTGTTATTCCTTTTGCCAAGTACCAGAAGGCCGTCTATAGCA
ACCAACTATCACTTGGCATGCGGTTTAGAATGATGTTTGAAACTGAAGAATCTGCAACAAGAAGGTACATGGGAACAATA
ACTGGTATAAGTGATATGGATCCTTTAAGGTGGAAAAACTCCCAATGGCGCAATATTCAGGTTGCATGGGATGAAGCAGC
ACCAAGTGAGAGACGCACCAGGGTTTCCCTTTGGGAGGTTGAACCTGTTATCGCTCCATTCTTCATTTATCCCTCGCCAT
TGTTCACTGCAAAACGTCCGAGGCAACCTGGGGTAACAGATGATGATAGCTCAGAAATGGACAATCTTTTTAAGCGGACC
ATGCCATGGTTTGGTGAGGAGGTTGGCAAGAGAGATCTGAGTACTCAAAACGGTTTAGTTCCTGGATTAAGTTTGGTTCA
GTGGATGAATATGCAACACAACCCCTCTCTTGCCAACACGGTTATGCAACCGGAATTGCTAAATTCGTTAGCTGGAAAAC
CTGTACAAACTCTGGCTGCGGCTGATCTATCTAGGCAAATTAGCTTCCAGCCCCAGTTCCTGCAACAAAATAACATCCAG
TTCAACACTTCGCTGCTACCTCCCCAAAACCAGCAGACCGAACAGTTAGCAAATGTAATAGCTACACCAAACCAATTGGG
AAGTGTTATAGTACCACAAAAGGCAGTTCAAAATTCCAGTTCTGAACAGAAACAGAATCTGGTTACACAACCACTGCAAG
TCAGCCAACCAATGGTTAGTGTGGCACAGCCTCAACTTGTCCATACTCAACTCCAGCAACCTCAAGTAGTTCTCCAGGCT
CAGCCTCAGCAACCTCAAGTCATTGTCCAAGCTCAACTACAACAACAGCAACCTCTGGTTCAAAATCACACCACCATACA
AAGTGGCCTTCAACAAATCCAGCTTCTGCAGCAACAGCAAGTTCAGCAGTCAGTGCAGGAACAACAGCAAATAAAGATAC
AGCCTTTTCAGGTACCTAATGATGCCAACATGGTAACACAGTTATCTGATCAGATGAAAATACAACTATTGAAGGCTCTA
CAGCCACAGCAGCCTCTGGTCATGGAACAGCAGAAAATGATATTTGATTTGCAGCAACAAGCAGTAAATTCTCAGTCAAC
TGCTCAGCAGTGCTCACAGGTAGCTACCCAAGTGGTTGGTTTGCATAGCAGTAGCACTAATCAGTACCCGACGCAGCAAA
AGACTCAACCTTTCAAAACATTTCAAGATTTTCCTGGGAATGCTGTTTCTATTGTAAAACCAGAAATTGTCACCTCCGTG
GGTGCTCGCTCTTTGCATGTGCCTGGTGGAGTGCAGTCAATGAAGATGGATGAAGTTCCCTCTTCTTCAACATCGCCATC
CACAAACAACAATCCTGTTATTTTGCGATCAACTCCAAGTAGCTCCAAGAACCAATGTTTACCTACTGCAGCAAAGGCTC
CTCAGTCATCTGTTGTATTGGGTTCTACACTTGAACAGGGTATGAAGCCTTGTGACAGTACACAACACCCAATGGTGATT
CCCAAGCTGGCTGAAGAAAGGCCAGCTACTGGACAAGACTACATGAACAGCACTCAGCTGGATTATTTGGATACGTCATC
TTCAGCGACTTCAGTTTGCCTTTCACAGGCTGACGGATCGCTGCAACAAAGTTTTCCACCTTCATCCTTCAATCAGCATC
AACCGTTGAGGGAAGCAGTTCCAGATAGCGAGTTTGAGGTTACAGATGCAGGAAATAACTTTCTATTTGGGGCAAATATT
GATGGCCATATGGAGCCTCTTAACGAAGACGATTTGCTTGGAACTGCCTTCGAAGCTGACAAGTACATGGAACAGATGCC
AGGAAACGGCATCTCTAACTACATTTCATCAAAGGATTCTCAGCAAGAGTTATCATCTTCAATGATCTCACATCCATTTG
GCGTTGCTGATATCGCGTTCAATTCCATAGATTCGTCGATCAATGATATCCAATTCTTAAACAGAAATTCCCGGGCTCCA
GGTCCTGTTCAACAACGTATGCGAACATACACCAAGGTGCACAAGCGTGGCGCTGTTGGAAGATCTATCGACATCAACAG
ATATTCTGGTTACGATGAACTGAAGCATGACGTTGCCCGTATGTTTGGAATTGAGGGGCAGCTCAGCGACCAAAACAGAG
TTGGCTGGAAACTGGTTTACGAAGATCACGAGAAGGATGTCCTATTAGTTGGTGATGACCCATGGGAGGACTTCGTGAAC
TGCGTGCGGTGCATCAGGATTCTTTCGCCGCAGGAAGAGAGGCAAATGAGGCTGGCCAGCGACTACGGAGACAGCTTTCT
TGGCAACCAAGCGTGTAGCAGCTCGGACGGGGGTCGTCCGTGGAGGGTCACCGGCGAC
TFome clones do not contain stop codon at 3'end.
Translation: MEAPGTSSGGAGGEGAGGTKVNEELWYACAGPLVALPPAGSLVVYFPQGHSEQVAASMRKDADAKIPSYPNLSSKLICIL
RSVTMLADPDTDEVYARMTLQPVSNVTHCDKETLLATELALKQTRPQTEFFCKTLTASDTSTHGGFSVPRRAAERIFPHL
DFSVQPPAQELQARDLHDAIWTFRHIYRGQPKRHLLTTGWSLFVSGKRLLAGDSVLFIRDGRQQLLLGIRRANRQPVNLS
SSVLSSDSMHIGILAAAAHAAANNSQFTVFYNPRASPSEFVIPFAKYQKAVYSNQLSLGMRFRMMFETEESATRRYMGTI
TGISDMDPLRWKNSQWRNIQVAWDEAAPSERRTRVSLWEVEPVIAPFFIYPSPLFTAKRPRQPGVTDDDSSEMDNLFKRT
MPWFGEEVGKRDLSTQNGLVPGLSLVQWMNMQHNPSLANTVMQPELLNSLAGKPVQTLAAADLSRQISFQPQFLQQNNIQ
FNTSLLPPQNQQTEQLANVIATPNQLGSVIVPQKAVQNSSSEQKQNLVTQPLQVSQPMVSVAQPQLVHTQLQQPQVVLQA
QPQQPQVIVQAQLQQQQPLVQNHTTIQSGLQQIQLLQQQQVQQSVQEQQQIKIQPFQVPNDANMVTQLSDQMKIQLLKAL
QPQQPLVMEQQKMIFDLQQQAVNSQSTAQQCSQVATQVVGLHSSSTNQYPTQQKTQPFKTFQDFPGNAVSIVKPEIVTSV
GARSLHVPGGVQSMKMDEVPSSSTSPSTNNNPVILRSTPSSSKNQCLPTAAKAPQSSVVLGSTLEQGMKPCDSTQHPMVI
PKLAEERPATGQDYMNSTQLDYLDTSSSATSVCLSQADGSLQQSFPPSSFNQHQPLREAVPDSEFEVTDAGNNFLFGANI
DGHMEPLNEDDLLGTAFEADKYMEQMPGNGISNYISSKDSQQELSSSMISHPFGVADIAFNSIDSSINDIQFLNRNSRAP
GPVQQRMRTYTKVHKRGAVGRSIDINRYSGYDELKHDVARMFGIEGQLSDQNRVGWKLVYEDHEKDVLLVGDDPWEDFVN
CVRCIRILSPQEERQMRLASDYGDSFLGNQACSSSDGGRPWRVTGD
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map