TFome Information for pUT6078

TFome Name:pUT6078
Genbank Insert ID:KJ727965
Protein Name:ZmARF21
Species: Maize
TF Family: ARF
Template: RT-PCR
Corresponding TF Gene: GRMZM2G390641
Transcript: T01
Vector: pENTR/SD/D-TOPO
Note: c.G25C p.A9P; c.C681T p.(=); c.C1034T p.A345V Not present in functional domain.

5' Primer Name: 3' Primer Name:
5' Primer Sequence: 3' Primer Sequence:
5' Primer Tm (º C): 3' Primer Tm (º C):
PCR Condition:
Nucleotide Sequence: ATGATTACTTTCGTGGACTCGGCGGCCATGGAGCTGGAGAGGGAGAGCGGCAGGTGCCTGGTGGACCCGCAGCTGTGGCA
CGCCTGCGCCGGCGGCATGGTCCAGATGCCGCCGGTGCACTCCAGGGTGTACTACTTCCCGCAGGGCCACGCCGAGCACG
CGCAGGGCCACGCCCACGCCGACCTCCCCGCCGGCCGGGTCCCGGCCCTCGTCCTCTGCCGCGTCGACGCCGTCCGGTTC
CTGGCCGATCCGGACACCGACGAGGTGCTCGCCAGGGTCCGCCTCGCCCCCGTCCGGCCCAACGAGCCGGACCACGCCGA
CGCCGCGGCGCCGGGCGCGCGGGAGGACAAGCCCGCGTCCTTCGCCAAGACGCTCACGCAGTCCGACGCCAACAACGGCG
GGGGCTTCTCCGTGCCGCGGTACTGCGCCGAGACCATCTTCCCGCGGCTGGACTACTCCGCCGACCCGCCCGTCCAGACC
GTGCTCGCCAAGGACGTGCACGGCGTCGTCTGGAAGTTCCGCCACATCTACCGCGGCACGCCCCGGCGCCACCTGCTCAC
CACCGGGTGGAGCGCCTTCGTGAACCAGAAGAGGCTCGTCGCGGGGGACTCCATCGTGTTCATGAGGACGGGGAACGGGG
ACCTCTGCGTCGGCATCCGGCGCGCCAAAAAGGGCGGCATCGGAGGAGGGCCGGAGTTCCCGCACCACCAGCCGCCAGAC
GGCGGCGGGTACGGGTACGGGTACGCCGGCTTCTCCACGTTCCTGAGAGGAGAAGAGGACGACGCGGCCGCGAGGGGCAA
GGTCAGGGTGCTGGTGCGGCCGGAGGAGGTCGTCGAGGCCGCCAACCTCGCGGCGAGCGGGCAGCCGTTCGAGGTGGTCT
ACTACCCGAGGGCGAGCACGCCGGAGTTCTGCGTCAAGGCGGGGGCGGTCCGCGCGGCCATGCGCACCCAGTGGTGCGCC
GGGATGAGGTTCAAGATGGCCTTCGAGACGGAGGACTCGTCCAGGATCAGCTGGTTCATGGGCACTGTCGCCGCCGTGCA
GGTCGCTGACCCCATCCGATGGCCCAATTCACCCTGGAGGCTTCTTCAGGTCGCTTGGGATGAACCGGACTTGTTACAGA
ACGTGAAGAGAGTGAGCCCATGGCTGGTCGAGCTTGTCTCAAGCACGCCGGCCATCCACCACCTCACGCCGTTCTCGCCG
CCAAGCAGGAAGAAGCTGTGTATCCCATTGTACCCGGAGGGCCACCAGCTCCCGGCGCCGATGTTCCACGGAAGCCCTCT
GGTGGGCCGTGGTGTTGGCCCGATGCGCTACTTCCCGGACGGCGGCACTCCTCCTGCAGGCATACAGGGAGCCAGGCATG
CGCAATTCGGCATATCTTTACCAGATCTCCACCACCTCACCAGGCTGCAGTCGAGTCTATCGCCGCACGCGCACGGGCTT
CGCCACCAGCTCGACCACGGCGCGCGGCCGAGGATCGCCGGCGGCCTCATCGTCGGCCACCCGGCAGCTCGGGACGACAT
CTCGTGCTTGCTCACCATTGGCACCGCCCCGCACAAGAAACCATCAGACGTCAAGTCGGCCGCGGCGGCGCCGGCGCCGC
AGCTGATGCTGTTTGGGAAACCGATTCTCACCGAGCAGCAGATATCTCTAGGCTTTCGGCCGCTGCCGGCGCCGAAGAAG
AGCCCGTCCGACGACGCTGCTGAGACTGAGAGGACGGTGAGCAACAACTCGGATGCCTCGAGCCCAGCTGGGACTGCGAG
TGGGAGCACGCCGTCCATCAGTGGAGGCGCCCCGTCGTCGTGCCAGGACAACAAGGCGGCGGCGACGGCGACGGCGACTG
ATGACGACGATCTCCTCGGGCACTGCAAGGTGTTCATGCAGTCGGAGGACGTCGGGCGCACGCTCGACCTCTCGGCTGTC
GCGTCGTACGAGGAGCTCTACCAGAGGCTGGCCGACATGTTCGGCGTCGACAGGGCCGAGCTGACGAGCCATGTCTTCTA
CCGCGACGGCGCTTCTGGAGCGCTCAAGCACGCCGGCGACGAGCCTTTCAGTGAGTTCACCAAGACCGCTCGGAGGCTGA
CCATACAAACGGACGCGAGGTAG
TFome clones do not contain stop codon at 3'end.
Translation: MITFVDSAAMELERESGRCLVDPQLWHACAGGMVQMPPVHSRVYYFPQGHAEHAQGHAHADLPAGRVPALVLCRVDAVRF
LADPDTDEVLARVRLAPVRPNEPDHADAAAPGAREDKPASFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSADPPVQT
VLAKDVHGVVWKFRHIYRGTPRRHLLTTGWSAFVNQKRLVAGDSIVFMRTGNGDLCVGIRRAKKGGIGGGPEFPHHQPPD
GGGYGYGYAGFSTFLRGEEDDAAARGKVRVLVRPEEVVEAANLAASGQPFEVVYYPRASTPEFCVKAGAVRAAMRTQWCA
GMRFKMAFETEDSSRISWFMGTVAAVQVADPIRWPNSPWRLLQVAWDEPDLLQNVKRVSPWLVELVSSTPAIHHLTPFSP
PSRKKLCIPLYPEGHQLPAPMFHGSPLVGRGVGPMRYFPDGGTPPAGIQGARHAQFGISLPDLHHLTRLQSSLSPHAHGL
RHQLDHGARPRIAGGLIVGHPAARDDISCLLTIGTAPHKKPSDVKSAAAAPAPQLMLFGKPILTEQQISLGFRPLPAPKK
SPSDDAAETERTVSNNSDASSPAGTASGSTPSISGGAPSSCQDNKAAATATATDDDDLLGHCKVFMQSEDVGRTLDLSAV
ASYEELYQRLADMFGVDRAELTSHVFYRDGASGALKHAGDEPFSEFTKTARRLTIQTDAR*
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis:
 
Plasmid Map