TFome Information for pUT6080

TFome Name:pUT6080
Genbank Insert ID:KJ727967
Protein Name:ZmbHLH116
Species: Maize
TF Family: bHLH
Template: RT-PCR
Corresponding TF Gene: GRMZM2G042895
Transcript: T01
Vector: pENTR/SD/D-TOPO
Note: c.G425A p.G142E; Not in functional domain.

5' Primer Name: R24-F 3' Primer Name: R24-R
5' Primer Sequence: caccATGGAAATGGGCGACAGCTTCGAGTACTAC 3' Primer Sequence: ATAGTAGCTCATCACGCTCGGCGGGCTC
5' Primer Tm (º C): 65.27 3' Primer Tm (º C): 66.48
PCR Condition:
Nucleotide Sequence: ATGGAAATGGGCGACAGCTTCGAGTACTACTGGGAGATGCAGCAGTACCTGGAGTCAGAGGAGCTCAGCCTCTACATGGG
CACCCAGGACGATGCCCTGTCCTGCTACGACTCCAGCTCGCCGGATGGCTCCATCTCCAACTCGTCCTGGGCGCCGGCGG
GCGTGGCGGCCACGGCGTCCGAGAAGCGGGAGGGCCCCGGCGGCGCGGCGGCCGCGAACAAGAACATCCTCATGGAGCGC
GACCGCCGGCGCAAGCTCAACGAGAAGCTCTACGCGCTGCGCAGCGTCGTGCCCAACATCACAAAGATGGACAAGGCGTC
GATCATCAAGGACGCGATCGAGTACATCGAGCAGCTACAGGCGGAGGAGCGGCGGGCGCTGCAGGCGCTCGAGGCCGGCG
AGGGGGCGCGCTGCGGCGGCCACGAGCACGGCGAGGAGGCGCGCGTGGTCCTGCAGCAGCCCGCCGCCGCCCCGGCGCCC
GTGGAGGTCCTGGAGCTGCGCGTGTCGGAGGTGGGCGACCGCGTGCTGGTGGTGAACGTGACGTGCAGCAAGGGCCGCGA
CGCCATGGCCCGCGTGTGCCGCGCCGTCGAGGAGCTCCGGCTCCGCGTCATCACCGCCAGCGTCACCTCCGTCGCCGGCT
GCCTCATGCACACCATCTTCGTCGAGGTGGATTCGGACCAGACGAATCGTATCCAGATCAAGCACATGATCGAGGCCGCT
CTCGCCCAGCTAGATGATGCCTCCGCGAGCCCGCCGAGCGTGATGAGCTACTAT
TFome clones do not contain stop codon at 3'end.
Translation: MEMGDSFEYYWEMQQYLESEELSLYMGTQDDALSCYDSSSPDGSISNSSWAPAGVAATASEKREGPGGAAAANKNILMER
DRRRKLNEKLYALRSVVPNITKMDKASIIKDAIEYIEQLQAEERRALQALEAGEGARCGGHEHGEEARVVLQQPAAAPAP
VEVLELRVSEVGDRVLVVNVTCSKGRDAMARVCRAVEELRLRVITASVTSVAGCLMHTIFVEVDSDQTNRIQIKHMIEAA
LAQLDDASASPPSVMSYY
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map