TFome Information for pUT6081

TFome Name:pUT6081
Genbank Insert ID:KJ727968
Protein Name:ZmbHLH169
Species: Maize
TF Family: bHLH
Template: RT-PCR
Corresponding TF Gene: GRMZM2G113257
Transcript: T02
Vector: pENTR/SD/D-TOPO

5' Primer Name: R30-F 3' Primer Name: R30-R
5' Primer Sequence: caccATGGACCGGGAGTGCTCACCGCTG 3' Primer Sequence: GTCAGTCACTTCTACGGCGCCACTGTCG
5' Primer Tm (º C): 69.31 3' Primer Tm (º C): 65.5
PCR Condition:
Nucleotide Sequence: ATGGACCGGGAGTGCTCACCGCTGGCAGCAACGACGCGGAGCGGGACGGGCAGAAGCCACAGCGAGGCGGAGCGGAAGCG
GCGGCAGCGCATCAACGCCCACCTCGCCACGCTCCGCACCCTCCTCCCTGCGGCGTCGCGGATGGACAAGGCGGCGCTGC
TAGGGGAGGTGGTGCGGCACGTGCGGGAGCTGCGGGGCGAGGCGGACGCCGCGGCGGCGGGCGCGGCAGTGGCCGTCCCG
GGGGAAGGCGACGAGGTCGGCGTCGAGGAGGGCCACCAGCACCGCTTCTGCCACGGCGGGGAGAGGGCCGCCAGGCGCGT
CAGGGCGTGGGTGTGCTGCGCCGACCGCCCGGGGCTCATGTCCGAGCTGGGCCGCGCCGTGCGGTCCGTCAGCGCGAGGG
CCGTGCGCGCGGAGATAGCCACCGTCGGCGGGAGGACGCGGAGCGTCCTGGAGCTGGACGTCGGCGGGCGGCACCACGAT
GGCGAGGGAACGTCGACGTCGTCACGGCCAGCGCTGCAGGCGGCGCTCCGGGCCGTGCTGCTCAGCCGGGAGGAGATGCT
CGGCGCCGAGTGCTACAAGAGGCAGCGCTTCTCGGCGCACCTCGCTAGGGTTTACGACAGTGGCGCCGTAGAAGTGACTG
AC
TFome clones do not contain stop codon at 3'end.
Translation: MDRECSPLAATTRSGTGRSHSEAERKRRQRINAHLATLRTLLPAASRMDKAALLGEVVRHVRELRGEADAAAAGAAVAVP
GEGDEVGVEEGHQHRFCHGGERAARRVRAWVCCADRPGLMSELGRAVRSVSARAVRAEIATVGGRTRSVLELDVGGRHHD
GEGTSTSSRPALQAALRAVLLSREEMLGAECYKRQRFSAHLARVYDSGAVEVTD
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map