TFome Information for pUT6082

TFome Name:pUT6082
Genbank Insert ID:KJ727969
Protein Name:ZmbHLH68
Species: Maize
TF Family: bHLH
Template: RT-PCR
Corresponding TF Gene: GRMZM2G115960
Transcript: T03
Vector: pENTR/SD/D-TOPO

5' Primer Name: R31-F 3' Primer Name: R31-R
5' Primer Sequence: caccATGTCCGACAGCAACGACTTCGTC 3' Primer Sequence: TTTTTGTAGTATTTGTGGATCTCCGGTATTT
5' Primer Tm (º C): 64.33 3' Primer Tm (º C): 56.73
PCR Condition:
Nucleotide Sequence: ATGTCCGACAGCAACGACTTCGTCGAGCTGCTATGGGAGAACGGCCAGGCGGTGGTGCACGGGAGGAGGAAGCAGCATCC
CCAGGCCGCCTTCCCGCCCTTCACCTGCGGCGCGGCCAGCAGCAGTAGAGCTCAAGAAAACCAGCCGGGTACTACCGACC
CGGTCTCGCTGTTCAAGACGGGAGGCCTCTTCGCCGACTTCTCGTCCGGCCTAGACGCCGCCCGTGGCAACGGTGACCTT
GACGACACCGTGCCCTGGATCCACTGCCCCATCGTCGAGGAAGACAGCGCCGCACCCGCACCTGCCCTCGCGGAGGGCTA
CAGCCCAGATTTCTTCTCGGAGCTCCATGCAGCGGCGTTAGCAGCGGCGGCGGCAGAGACGAACCTCAGCCCTCTGCCAC
CACCGGTCCAGCACAACAGAAGCACCCCGGTTGCCACCACCAGCAGAGGACCAGAACCCTCGAAGGAAGCCCCGCGCATA
CCAGTACCAGGTCCAGGCAGCAGGCCCGAGCCACAATCTGAGTTCGCGGCCACCAGGAAACCTCGGCCGGAGAGCGGTGG
AGAGGGATTGATGAACTTCTCCCTCTTCTCTAGGCCTGCAGCCTTGGTCCGGGCAAGCCTACAGAGGCCACCGCCACCGC
AGACAGGCACTGACAAGGTGTCCAATGTCACCACGAGCACCCGCGTGGAGTCGACGGTTCTACAGTCGGCTAGTGGGCCA
AGAATCGCCCCTGTGTTCACGGACCAGAGGACGGCGTGGTCACAATCCAAGGAGGTGCGGTTTTCATGCGCACCAGCGCT
GGCGGCTGGTAACCTGCACCAGGATATGCCTCTGGGAAGACCTGGCAACAACATGACTCCCCAGGGGAAAATGGAGACCA
AAAAGGCTTGTGAGGTTGCAGTCGCTACTCCATCGCTCTGCTCCGGCAATGGCGAGTCCTGGCGCGAACAAAAGAGGAAG
AGTCAGGCCGAATGTTCTGCAAGTCAAGACGATGATCTTGATGATGAGTCCGGTGGGATGCGAGGATCAGGCGGCAGAGG
TACGAAGCGCAGCCGCACCGCGGAGGTGCACAATTTGTCCGAAAGGAGGAGAAGGGACAGGATCAATGAGAAAATGCGCG
CCCTGCAAGAGCTCATCCCCAACTGCAACAAGATTGACAAAGCCTCCATGCTGGATGAAGCGATCGAGTACCTCAAAACC
CTCCAGCTTCAAGTTCAGATGATGGCCATGGGAAGTGGACTGTGCATTCCTCCCATGCTGCTGCCGCGAGCCATGCAGCT
GCAAATTCCTTCAATTGCTCATTTCCATCATCTCGGCATGGGATTGGGTTATGGGATGGGTGTCCTCGATATGAACAGCA
CAGCGGCAGTTCCATTTCAGCCCATCCCTGGTGCTCACTATACTTGTCCGATGATCCCAGGCACGCCACCACAAGGTCTT
GGAATTGGAATGCCTGGCACAAACACGATGCCAGTGTTTGGACTCCCTGGGCAAGCAATCCATCCCTCAGCGTCTAGCGT
ACAGCCATTCCCATCGTTGGCGGGTCTTCCTGTTAGGCCAAACCTGGCACCTCAAGTCCCAGCCGTCATGGCTAACATGG
TGCAGGAGCAACAGCAAGGCGTAGCGACTCAGCAGCAGCAGAGTCTGAATAATGAAGCTCAACAGAAAGCAAATACCGGA
GATCCACAAATACTACAAAAA
TFome clones do not contain stop codon at 3'end.
Translation: MSDSNDFVELLWENGQAVVHGRRKQHPQAAFPPFTCGAASSSRAQENQPGTTDPVSLFKTGGLFADFSSGLDAARGNGDL
DDTVPWIHCPIVEEDSAAPAPALAEGYSPDFFSELHAAALAAAAAETNLSPLPPPVQHNRSTPVATTSRGPEPSKEAPRI
PVPGPGSRPEPQSEFAATRKPRPESGGEGLMNFSLFSRPAALVRASLQRPPPPQTGTDKVSNVTTSTRVESTVLQSASGP
RIAPVFTDQRTAWSQSKEVRFSCAPALAAGNLHQDMPLGRPGNNMTPQGKMETKKACEVAVATPSLCSGNGESWREQKRK
SQAECSASQDDDLDDESGGMRGSGGRGTKRSRTAEVHNLSERRRRDRINEKMRALQELIPNCNKIDKASMLDEAIEYLKT
LQLQVQMMAMGSGLCIPPMLLPRAMQLQIPSIAHFHHLGMGLGYGMGVLDMNSTAAVPFQPIPGAHYTCPMIPGTPPQGL
GIGMPGTNTMPVFGLPGQAIHPSASSVQPFPSLAGLPVRPNLAPQVPAVMANMVQEQQQGVATQQQQSLNNEAQQKANTG
DPQILQK
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map