TFome Information for pUT6100

TFome Name:pUT6100
Genbank Insert ID:KJ727984
Protein Name:ZmCOL7
Species: Maize
TF Family: C2C2-CO-like
Template: RT-PCR
Corresponding TF Gene: AC233888.1_FG002
Transcript: T002
Vector: pENTR/SD/D-TOPO

5' Primer Name: R167F 3' Primer Name: R167R
5' Primer Sequence: caccATGAAGGGTGACGAGAAGTCGGC 3' Primer Sequence: ATGAGTGGGCACGACACCGTAGTC
5' Primer Tm (º C): 64.4 3' Primer Tm (º C): 62.63
PCR Condition:
Nucleotide Sequence: ATGAAGGGTGACGAGAAGTCGGCGGGCGGGGCCCCTGCGTACTGGGGCCTCGGCGCGCGGCCCTGCGACGCATGCGGCGC
CGAGGCGGCGCGCCTCTACTGCCGCGCGGACGCGGCGTTCCTGTGCGCCGGGTGCGACGCGCGGGCGCACGGCGCCGGGT
CGCGCCACGCGCGAGTGTGGCTCTGCGAGGTCTGCGAGCACGCGCCGGCGGCGGTCACGTGCCGCGCCGACGCGGCCGCG
CTCTGCGCCTCCTGCGATGCCGACATCCACTCGGCGAACCCGCTCGCGAGCCGCCACGAGCGCCTTCCCGTGGCACCCTT
CTTCGGCGAGCTGGCCGACGCGCCCAAGCCCTTCGCCTCGTCGGCGGCCGTGCCCAAAGCGGCCGACGACGACGGGAGCA
ACGAGGCCGAGGCTGCGTCGTGGCTCCTTCCCGAGCCCGACCACGGGCAGAAAGAAGGCGCCACGACGGAGGTGTTCTTC
GCGGACTCCGACCCATACCTCGACCTCGACTTCGCGCGTTCCATGGACGACATCAAGACCATCGGCGTCCAGGGCGGGCC
ACCAGAGCTCGACCTCGCCGGCGCCAAGCTCTTCTACTCCGATGACTCCATGAACCACAGTGTATCATCGTCGGAGGCGG
CGGTGGTGCCCGACGCGGTGGCTGGCGCGGCGCCCGAGGTGGCAGTGGTCTGCAGGGGCCTGGAGCGGGAGGCGCGGCTG
ATGCGGTACCGGGAGAAGCGCAAGAGCAGGCGGTTCGACAAGACGATTCGGTACGCGTCCCGCAAGGCCTACGCTGAGAC
GCGGCCGCGCATCAAGGGCCGGTTCGCCAAGCGCACGCCCGGGGCTGGGGCGGACGGCGAGGAGCCGCTGGAGGAGCACG
AGGAGATCTACTCCTCGGCCGCGGCCGCCGTGGCTGCGCTCATGGCCCCCGGGGGAGCCGACGCGGACTACGGTGTCGTG
CCCACTCAT
TFome clones do not contain stop codon at 3'end.
Translation: MKGDEKSAGGAPAYWGLGARPCDACGAEAARLYCRADAAFLCAGCDARAHGAGSRHARVWLCEVCEHAPAAVTCRADAAA
LCASCDADIHSANPLASRHERLPVAPFFGELADAPKPFASSAAVPKAADDDGSNEAEAASWLLPEPDHGQKEGATTEVFF
ADSDPYLDLDFARSMDDIKTIGVQGGPPELDLAGAKLFYSDDSMNHSVSSSEAAVVPDAVAGAAPEVAVVCRGLEREARL
MRYREKRKSRRFDKTIRYASRKAYAETRPRIKGRFAKRTPGAGADGEEPLEEHEEIYSSAAAAVAALMAPGGADADYGVV
PTH
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map