TFome Information for pUT6138

TFome Name:pUT6138
Genbank Insert ID:KJ728005
Protein Name:ZmbHLH126
Species: Maize
TF Family: bHLH
Template: RT-PCR
Corresponding TF Gene: GRMZM2G057413
Transcript: T02
Vector: pENTR/SD/D-TOPO

5' Primer Name: R25-F 3' Primer Name: R25-R
5' Primer Sequence: caccATGATTAGCATGGACCACCAGATGTTC 3' Primer Sequence: GATAAAAAAATTGAAGGAAACGGCAGG
5' Primer Tm (º C): 62.1 3' Primer Tm (º C): 55.58
PCR Condition:
Nucleotide Sequence: ATGATTAGCATGGACCACCAGATGTTCGACGACCCCTTCGGGAGCAGCGGCATCTCGTCGCTGGAGGCGGACATCTTCTC
CGCCGCCGCCGGCAGCCAGCTGCCGTCGCCGCCGTGGCCGGACTTCGACGACGACTACGACATCCCCGACCTCTCCGCGC
TGCCCGCCAACGCCGCCACCTCCTCGGGCGGCGGCTACGGCTCCGGCGGATCCGGCGGACACCGCAAGCTCAGCCACAAC
GCGTACGAGCGTGACCGACGGAAGCAGCTCAACGACCTCTACTCCTCGCTCCGCTCCCTCCTCCCGGACGCTGACCACAC
CAAGAAGCTGAGCATCCCCACCACCGTGTCCCGAGTCCTCAAGTACATCCCGGAGCTGCAGAAGCAGGTGGACAACCTGG
AGAGGAGGAAGCGGGAGCTGACCAACGCCAACTGCAAGCCGGGAGTTCTCAACACCAGCGAGATCGTAACTACTCCCATT
GTTTCTGCTACTTGCCTCAACGACACGGAGATCATGGTTCAGGTCAGCCTGCACAGCAATGTGGCAGCCACGGCTCTCCC
TCTCTCCAAGTGCATAAAGGTGCTGGAGGACGCAGGCCTTCACCTCATCAGCTCATCAACCTACTCCACCTTTGGGAACA
AGACATTCTATAGCCTCCATCTTCAGGTGTGCATGCATGTTCATTCAATGGTTCCTGCCGTTTCCTTCAATTTTTTTATC

TFome clones do not contain stop codon at 3'end.
Translation: MISMDHQMFDDPFGSSGISSLEADIFSAAAGSQLPSPPWPDFDDDYDIPDLSALPANAATSSGGGYGSGGSGGHRKLSHN
AYERDRRKQLNDLYSSLRSLLPDADHTKKLSIPTTVSRVLKYIPELQKQVDNLERRKRELTNANCKPGVLNTSEIVTTPI
VSATCLNDTEIMVQVSLHSNVAATALPLSKCIKVLEDAGLHLISSSTYSTFGNKTFYSLHLQVCMHVHSMVPAVSFNFFI
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map