TFome Information for pUT6154

TFome Name:pUT6154
Genbank Insert ID:KJ728018
Protein Name:ZmbHLH94
Species: Maize
TF Family: bHLH
Template: BT054416
Corresponding TF Gene: GRMZM5G849600
Transcript: T01
Vector: pENTR/SD/D-TOPO
Note: c.G489T p.(=) Not present in template FlcDNA.

5' Primer Name: UT3313up 3' Primer Name: UT3313dn
5' Primer Sequence: caccATGGATGAAGTGTGGTGCGGC 3' Primer Sequence: GGCTGCGGCCACGAGGG
5' Primer Tm (º C): 60.5 3' Primer Tm (º C): 65.5
PCR Condition:
Nucleotide Sequence: ATGGATGAAGTGTGGTGCGGCCTGGACCTGCAGCTGCAGGCGGACGGCATCCACGCTGGCCCTGACCTCCATGGCCATGA
CCATGACCCCTTCTGGTCAGCTCTGGCAGAGTGCGCTGCCAGCTTCCTCGCCAGCGACGCCGACGACACCGGCGGCCTGG
TGGCCTCCGCTGGCGACGTCGTTCACGCCAAGGCGGACGGCATGGACACGAGCAGCTTCTTCGCCGACAACGACCACCAC
GGCCTGACCCAGCGCCGAGACGAGCAGCAGCAGCAGCAGCCTGTGCACTCGTCGTCCTCGCTGTCCTCCAAACGCTCGCT
CTCCATCGACAGCGGGGGCTCCTCGTCCTCCACCCTCATCCCGCCGCTCGACGGCGCCGCCGCTGCCGCCTTCTCGCCGG
CGCCCCCGCAGCCGCAGGACCCGTTCGCCGGGGACGACGAGGCCATCATGCTGGCCATGATGGCCGTCATCTCCTCCGCG
TCGCCTTCTTCCTCCGAGTCCTCGTCGCCGCCGCACCGAGCCGCCGGCGCCGGCGCCGTGCAGCCGCGCGTACACCTGCA
CGGCGGGGACGACAGCGCCGGCCACGTGACGGTCAGGACCAGCAGCCTCGCCGTGGCGCCCACCAGCGCCGCTGCACGGC
AGCAGGACGACGCCTGCATGGCGGCGGGGAGCAACAACAGCAGCCAGGTGTACCACATGATTTCCGAGAGGAAGAGGCGG
GAGAAGCTCAATGACAGCTTCCACACGCTCCGGTCGCTCCTTCCACCCTGTTCCAAGAAGGACAAGACGACGGTGCTGAC
GAACGCGGCGAGCTACCTCAAGGCGCTGGAGGCGCAGGTGTCGGAGCTGGAGGAGAAGAACGCCAAGCTGGAGAGGCACG
TCCCCCGCGACGACGGCGGCGGCGGCACGGCCGCCACGGCGGCGGCGGTGGCGCACCGGAGAGCCAGAGTGCATGTCGCC
AGGGCGGCGCCGGGCGAGCCGCAGGTGAGCGTGACGGTGATGGTGATGGTGGAGTGCGACATCGTCGACCTGGTGCTGCG
CGTCCTGGAGTGCCTCCGGTGGATGGGCGGGGTGGTGAGCGTGCTGTCCGTCGACGCCGACACCTACTCGCCGCAGGCGA
TGCTCAAGGCGCTCGCCAACATCAAGCTGCACATCGTGGACGGCGACTGCTGGAACGAGGCGCTGTTCCACGAGGCCATG
ACGAAGGCCGTGCACGACGCGACCTCGCCTTCCTCCTCGCCCTCCTGCGCCGCCGTGGCCCCCCTCGTGGCCGCAGCC
TFome clones do not contain stop codon at 3'end.
Translation: MDEVWCGLDLQLQADGIHAGPDLHGHDHDPFWSALAECAASFLASDADDTGGLVASAGDVVHAKADGMDTSSFFADNDHH
GLTQRRDEQQQQQPVHSSSSLSSKRSLSIDSGGSSSSTLIPPLDGAAAAAFSPAPPQPQDPFAGDDEAIMLAMMAVISSA
SPSSSESSSPPHRAAGAGAVQPRVHLHGGDDSAGHVTVRTSSLAVAPTSAAARQQDDACMAAGSNNSSQVYHMISERKRR
EKLNDSFHTLRSLLPPCSKKDKTTVLTNAASYLKALEAQVSELEEKNAKLERHVPRDDGGGGTAATAAAVAHRRARVHVA
RAAPGEPQVSVTVMVMVECDIVDLVLRVLECLRWMGGVVSVLSVDADTYSPQAMLKALANIKLHIVDGDCWNEALFHEAM
TKAVHDATSPSSSPSCAAVAPLVAAA
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map