TFome Information for pUT6156

TFome Name:pUT6156
Genbank Insert ID:KJ728020
Protein Name:ZmARF8
Species: Maize
TF Family: ARF
Template: BT066328.1
Corresponding TF Gene: GRMZM2G352159
Transcript: T03
Vector: pENTR/SD/D-TOPO

5' Primer Name: UT-2848up 3' Primer Name: UT-2848dn
5' Primer Sequence: caccATGAACATCGAACTGAAGGTTGAGCC 3' Primer Sequence: GCAGTTCTCGGAATCGAGAGCC
5' Primer Tm (º C): 62.5 3' Primer Tm (º C): 59.9
PCR Condition:
Nucleotide Sequence: ATGAACATCGAACTGAAGGTTGAGCCGGATACTGATGAGGTGTACGCCCAGCTCACCCTGCTCCCTGATAAGAAGCAAGA
TGAGAATACATCTACAACAGTGGAGGAAGAGGAGGTGGTGGTGCCTCCTGCGCTACCAGCCACAAATGAGGGTCCTCACA
TCCATTCCTTCTGCAAGACATTGACTGCCTCAGACACAAGCACACATGGTGGTTTCTCAGTGTTGCGCCGGCATGCAGAT
GAGTGCCTCCCACCATTGGATATGAGTCAACATCCCCCAAATCAAGAATTGGTGGCCAAGGACCTGCATGGGGCCGAGTG
GCGGTTCCGTCACATCTTTCGAGGTCAGCCACGGAGACATCTCCTGCAAAGTGGTTGGAGTGTTTTTGTGAGCGCCAAGC
GTCTTGTCGCGGGGGATGCCTTCATATTTCTCAGAGGTGAGAATGGGGAGCTCCGTGTTGGAGTTCGGCGTGCACTGAGG
CACCAAACCACTATCCCATCTTCAGTCATATCAAGCCACAATATGCATCTTGGTGTTCTTGCAACAGCATGGCATGCAGT
GAACACTGATAGTATGTTCACTGTCTACTACAAGCCAAGGACTAGTCCAGCTGAATTTGTGGTTTCGCGAGATAGGTACT
ATGAATCACTGAAACGAAATTATTCAATAGGGATGAGATTTAAGATGAGATTTGAAGGTGAAGAGGCAGCAGAGCAAAGA
TTCACTGGCACAATAGTTGGAATAGGTGCTTCTGATCCATCTGGTTGGGCTGACTCAAAATGGCGTTCCCTTAAGGTGAG
ATGGGATGAACCTTCTTCTATTTCTCGTCCTGAAAGAGTTTCTCCTTGGCAAATAGAACCTTCTGTTAGCCCATGTCATG
TGAACCCTCTTCCAGTTAGATTCAAGAGGTCTCGATCAAGCGTTAATGCTTTGCCATCTGACGTGTCTACTGTAACCAGA
GAAGTCACTTCTAAAGTCATGGCAGACTCGCAGCAAAATAGTCTCACAAGAGCCTTGCACAATCAAGGAAGGACACAATT
GACAGTTCGATACCATGATAACAGTGATGTGAAGACTACTCAGGATCTTACCGTGTGGTCTTCAGGAACTGAGCAACAGA
GAAACAATATTGCTGCCCAGACAAAGCTATGTCTGGAGGGTTGGACGCCAACTAGAAGTCCTGAAGGCTACAATCAGATA
TTCTCGGCATTTAAACCACTGAAAGATATACATAACCCACTTGGTCCTTTTCCTAGTCAAATATCTGGGACTCACTCAAA
TAGCTGGGACACAGCTGATGCTCGTTATCCAGTCCAACAAGCTAATTACAGCATGTTACCTGGCACATGGTCTTTGAGGC
CTCATAACAGTGGTTTTAGGATGAATCAACAAAATTATCTAGTGATGCCTGAAGGTGCAAATTTTACGGGGAAATCAGCT
TTCACTTCACTTCAGGACCATGGCACTGATAAATGCTCCACAGGCTGCTTTGGTCATATTGAGTCAAGTTCCCACACAGA
CCATGCATCCTCAAGTTTGATCAGGCCCCAGCCTTTGGTCCTTGGAAATGGTGTTCAGAAAAGCAAAGGCACTTCATTTA
AATTATTTGGGATTCCCCTTGGCAGCCCAGAAAAATCTGAACCTCTGGTATCCCCACCAAGTGTCGCATATGACGGGAAA
CTTCAAACTTCTCCATCAGAAAAAGGGAATCAGCTAGACGTAGTTGAAGTGGATAATTGTTCTCATCCTTCTAAGACTGT
GAAGCCACTTGATGGTCCTCAGTCAGATTCTATTACAGAGAATAATCAGCCTTCTCCAGAAGCTACCCTTAATATCCAGA
ACAAAGTGCAAAGTAGTTCCACCAGAAGCTGCAAGAAGGTTCATAAGCAAGGTAGTGCCCTCGGCAGGTCGATTGATCTA
ACAAAGTTCGCCTGCTATGATGAGCTGATTGCTGAACTGGATCAGATGTTTGACTTCGATGGTGAGCTGAAGAGTCCATG
CAAAAGTTGGTTAGTTGTCTACACTGACAATGAAGGCGATATAATGCTGGTTGGTGATGACCCCTGGAATGAATTCTGCG
ATATGGTCCACAAGATCTTCATCTACACGAGAGAGGAAGTCGAAAGGATGAACCCAGGTGCCCTGAACTCAAGGTCTGAA
GATAGTCTATCTGACTCGCTGGGAAGAGGGGTAGCTTCCAGAGATCCCCGAGGAGGCGGGTCTACTTCGGCTCTCGATTC
CGAGAACTGC
TFome clones do not contain stop codon at 3'end.
Translation: MNIELKVEPDTDEVYAQLTLLPDKKQDENTSTTVEEEEVVVPPALPATNEGPHIHSFCKTLTASDTSTHGGFSVLRRHAD
ECLPPLDMSQHPPNQELVAKDLHGAEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFLRGENGELRVGVRRALR
HQTTIPSSVISSHNMHLGVLATAWHAVNTDSMFTVYYKPRTSPAEFVVSRDRYYESLKRNYSIGMRFKMRFEGEEAAEQR
FTGTIVGIGASDPSGWADSKWRSLKVRWDEPSSISRPERVSPWQIEPSVSPCHVNPLPVRFKRSRSSVNALPSDVSTVTR
EVTSKVMADSQQNSLTRALHNQGRTQLTVRYHDNSDVKTTQDLTVWSSGTEQQRNNIAAQTKLCLEGWTPTRSPEGYNQI
FSAFKPLKDIHNPLGPFPSQISGTHSNSWDTADARYPVQQANYSMLPGTWSLRPHNSGFRMNQQNYLVMPEGANFTGKSA
FTSLQDHGTDKCSTGCFGHIESSSHTDHASSSLIRPQPLVLGNGVQKSKGTSFKLFGIPLGSPEKSEPLVSPPSVAYDGK
LQTSPSEKGNQLDVVEVDNCSHPSKTVKPLDGPQSDSITENNQPSPEATLNIQNKVQSSSTRSCKKVHKQGSALGRSIDL
TKFACYDELIAELDQMFDFDGELKSPCKSWLVVYTDNEGDIMLVGDDPWNEFCDMVHKIFIYTREEVERMNPGALNSRSE
DSLSDSLGRGVASRDPRGGGSTSALDSENC
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map