TFome Information for pUT6169

TFome Name:pUT6169
Genbank Insert ID:KJ728030
Protein Name:ZmbHLH79
Species: Maize
TF Family: bHLH
Template: RT-PCR
Corresponding TF Gene: GRMZM2G173862
Transcript: T01
Vector: pENTR/SD/D-TOPO
Note: c.G774A p.(=)

5' Primer Name: R38-F 3' Primer Name: R38-R
5' Primer Sequence: caccATGGATCCGTTCTACTTCGGCCCGGAC 3' Primer Sequence: ATCCATCTGGACAGTTTCGACTTGACAGCTG
5' Primer Tm (º C): 67.48 3' Primer Tm (º C): 62.86
PCR Condition:
Nucleotide Sequence: ATGGATCCGTTCTACTTCGGCCCGGACCAGCTGGATGCCGCCGCCGTCGACGAGGACTACCTGACGAGCCTCGGCCTGGT
GGTCCTCTCGCCGGAGCCAGTGGCGCCGTTGCCTGGCGGCGCATTTGAGGCGTACCAGCGGCGTGCGCCGGCGTTGCTGG
AGCACTCCCTGCAGACGATGAGCCGGCGGTACAGTGGAGAGCACAACATGCACCGGAGGATGTTCAGTTACCTGAGACGC
GTAGCTCATGACGCCGGCGCCGCCGTGGTGGCGGCCCCAGCGTTCCCGGCGCCCGCGCGCGAGAGCGTTCCCGGCTTCGG
GGTTGGCACGTCGCAGGCGCCGCGAAGCTCGCGGTTCCGGAACATCATGCGCGAGCGGCTGCGGCGGGAGCGCCTCAGCC
AGGGATTCGCCGACCTCCACGCTCTTCTGCCCCACGGCGCGTCGTCAAAAGGTGGCAAGAACGACATCGTCGGCGCGGCG
GCCGGCTACGTCAGGGAGCTGGTGGCCAGGAAGGAGCAGCTCAGCGCCAGGAACCAGGAGCTCCTAGAGAAGGCCGCGAG
CCGCTGGAAGCAGCAGGGAGGCACGAGGAGTGGTGTCGGGCGGGGCATGGTGGTGAAGGTGCAAGCCGAGAGCCAAGACC
ATTCGATGGCGCTTGGTGCGTTTGTGAGGGTGCTCCAGCGGCTCAAGGCCATGGAGGCCGGGCTGCAGGTGACGGCGATC
CGGACGCGCTTCTCCGCGGGAGGCGTGTGGATGAACATCGGAGTGGAAGGCCAAGTATCCGCTCGTGATGTGGACAAGTC
AATAACAAACGCCTTGATAGAGCTGGAGGGGAACGATCCAAGAAGCAGCAAGCCCAGATTCAGCTGTCAAGTCGAAACTG
TCCAGATGGAT
TFome clones do not contain stop codon at 3'end.
Translation: MDPFYFGPDQLDAAAVDEDYLTSLGLVVLSPEPVAPLPGGAFEAYQRRAPALLEHSLQTMSRRYSGEHNMHRRMFSYLRR
VAHDAGAAVVAAPAFPAPARESVPGFGVGTSQAPRSSRFRNIMRERLRRERLSQGFADLHALLPHGASSKGGKNDIVGAA
AGYVRELVARKEQLSARNQELLEKAASRWKQQGGTRSGVGRGMVVKVQAESQDHSMALGAFVRVLQRLKAMEAGLQVTAI
RTRFSAGGVWMNIGVEGQVSARDVDKSITNALIELEGNDPRSSKPRFSCQVETVQMD
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map