TFome Information for pUT6177

TFome Name:pUT6177
Genbank Insert ID:KJ728034
Protein Name:ZmABI22
Species: Maize
TF Family: ABI3-VP1
Template: BT054847
Corresponding TF Gene: GRMZM2G008356
Transcript: T01
Vector: pENTR/SD/D-TOPO
Note: c.C1004T p.A335V Not in functional domain. Present in template FlcDNA.

5' Primer Name: UT-2850up 3' Primer Name: UT-2850dn
5' Primer Sequence: caccATGTCGTCCCCGGGGCCACA 3' Primer Sequence: AGTTGCATTGTCTCGGCTCAACAAACC
5' Primer Tm (º C): 69.4 3' Primer Tm (º C): 61.6
PCR Condition:
Nucleotide Sequence: ATGTCGTCCCCGGGGCCACAGCAGGCGCCGCCGGCGCAGCCTCCCCCGCCGCAGGCCGCCGCGCCCCCCACCGCCGCTCC
CGCAACGGTCTCCGCGACCTCCATCTCGGTGCAGCTGCCTCCTATCCAGCCGAAACCGCCGCCGCAGCCGGGTCCCACTT
CCGGCCCGCAACCGCCGACGCCGGCGCAGCTCTTGAATCTGGGTCCGCAGCCGCCGCTGTACAGGGGCCCGATCTGCTGG
AACTCCTATTGTAAGGACCCCGACCCCAACTCCTTCGGCCGCCGCGGGTGGAAGGTCCGCTCGGGCCCACCCTACTCCGT
GTACGCCGACCTCTGCGGGAGATGCTATTCTCAGTTTGAACAGGGGATATACTGCGAAACGTTCCATTCCGAAGAGGGCG
GCTGGAGGAACTGTGAATCCTGCGGGAGGAGGGTACATTGTGGCTGCATCGTGTCCATCCACAAGTATCAGCTCCGTGAC
GCTGGTGGGGTTGACTGCGCCAAGTGTGCTCGGAGCACCCGTGCTGCCATGGCCCCACCAAGTCCCGTATGGACAAATCC
TATTCATAGTTCTCAAAATGTATCTGACAGAAAAGACATTACTGTAAAGAGCTGGAGACCTCCTGCTGGGCAAATTTCAA
GTCAGTGGAGGCAGACTAATCTGTGGAGCGTGTCCAGTATACAGTCAGACTTGCAGCAGCGTCTAGCTTTTGAGTTTGAT
AGGCCTAGCGGCAGTGAAAAGCTACTTCCTGGGCGCACTTTTATTCATTCCCAGGAAAGGAAATTTGATGACATGCATGA
CAGACCAGCAACTCCTGCGGGCATGAACCACATTATGAGGGAGAGAGATCCCAATGGGCACGGTCAGACCACTAATATGG
ATCCAGCATACTCTTATACCCTCTATCACAGAGATGGATCGCATCCAAATAATCTTCATGATTCTAATCACCATTGTGGA
GAAAATGACTCTTTGTCTTCTAGGAAAGTGGCAATGCCAGAAGTTTCTACAAGTGTGGATGCTGGTTTCAAGCTTGATTC
ACATCATACATCTAATTTAAAGGATGATCCACCATCCCTTTCAGTTGGTCTGGCTTCTAATTTTGCACCACAGAATGGAC
CGAAAGACCATATCAGAATTGCACCTACTCAGCAGCAATCACAAATGACTTCCTCCTCATTGCAGAAACAATTCTATTCT
CATGCTGTAACTGGTTATAATGAATTTCAAGCACAGATGCGCAATGGAAGACCCAGAATGGATTCAAAGGCTAGATCACA
ATTACTTCCCCGCTATTGGCCTAGAATAACAGATCAAGAGCTACAACACTTATCTAGCGATTCAAATTCTGTTATTACTC
CTTTGTTTGAAAAGATGCTAAGTGCTAGTGATGCTGGGCGGATTGGTCGTTTAGTTTTGCCAAAGAAGTGTGCTGAGACA
TACTTCCCTCCAATCTCCCAACCTGAAGGGCTCCCTTTAAAGGTTCAGGATGCCAGTGGTAAAGAATGGATATTCCAATT
CCGTTTCTGGCCAAATAATAATAGCAGGATGTATGTATTGGAGGGTGTCACACCTTGCATTCAGTCAATGCAGTTACAAG
CAGGCGACACAGTAACCTTTAGTCGAATAGACCCAGAAGGGAAATTGATCATGGGCTTCAGGAAGGCAACTAACAATTCT
TTCGAACAGGAGCAAGCTACAAAGCCTGCCAATGGCGCCCTAGCAACTTCAGAAGCAAATGGTAAAGTTTCTGCCCCAGA
TTCCAGTCCAAATGCTGCAGTTTCCCGTCAAAACAAGCTCAACACAGAGACCAAAAGTTCTAGTCCTGTGGAACAAGCCA
CTGCATTGAAAATGGACAAGGATGGATTAACACAGAAGGAAGGGCCTGGAACTGGTAGTTCTTCCCCAGGTTCTGTCAAG
AGAAAAACAACTATTCTTGGTCAAAAGAATAAAAGATTACGGATGGATAATGAGGAATCAATGGAGTTGAAGATAACATG
GGAGGAAGCTCAAGAATTGCTTCGCCCTCCTCCTAAGGCCCCATCCATTGTTATTGTTGATGGCCATGAGTTTGAGGAAT
ATGAGGAGCCACCGGTACTTGGAAGGAAGACTTATTTTGTAGCAGATAAATCAGGTTCGAACCATCAATGGGCCCAATGT
GAAGATTGTTCCAAATGGAGGAAACTTCCAATAGATGCTCTGTTGCCCTCCAAATGGACCTGCTCTGACAACAAATGGGA
TCCAGAGAGGTGTTCTTGCGAATCTGCACAGGAAATAAGTATAGAGGAGCTTGCAGAATTCATTCCTATAAAACCTGCCA
AAAAGCCCAAATTGAAGATAGAATCTGATGCTATCGATGCTTCAGATGGGCTGGACACGCTTGCAAACCTTGCGATTCTT
GGTGAAGGTGAAGCTCTCCCTTCACAGCCAACAACAAAACATCCCCGCCATCGTCCGGGCTGCTCATGCATCGTCTGCAT
CCAACCACCAAGCGGGAAGGGTCCAAAGCACAAGCAAACTTGCACCTGTAACGTTTGTATGACGGTTCGCCGCCGTTTCA
GGACACTCATGCTTCGACGCGAGAAGAAGGCGACAAAGGATCTGTCTCGCAAGAAAGAGACGGGCCAATCCAGTGAGAAG
GCCACACAACAAGCTGTGTCCGGACCTCCAGGAGCCAATGCCACTGCAACCAGATCTGCCCAGAAAGCAGATGGAAACAC
CGATGGACCTGAAGACATGGCCGTCGATCACAAGGTGACAACATCCTCTCCCGTCAAGAACCATATTGACCTGAACATCC
AACCTGAACGGGACGATGAGCAGTCACCGAAATCTGGTGCGGCTGGTTTGTTGAGCCGAGACAATGCAACT
TFome clones do not contain stop codon at 3'end.
Translation: MSSPGPQQAPPAQPPPPQAAAPPTAAPATVSATSISVQLPPIQPKPPPQPGPTSGPQPPTPAQLLNLGPQPPLYRGPICW
NSYCKDPDPNSFGRRGWKVRSGPPYSVYADLCGRCYSQFEQGIYCETFHSEEGGWRNCESCGRRVHCGCIVSIHKYQLRD
AGGVDCAKCARSTRAAMAPPSPVWTNPIHSSQNVSDRKDITVKSWRPPAGQISSQWRQTNLWSVSSIQSDLQQRLAFEFD
RPSGSEKLLPGRTFIHSQERKFDDMHDRPATPAGMNHIMRERDPNGHGQTTNMDPAYSYTLYHRDGSHPNNLHDSNHHCG
ENDSLSSRKVAMPEVSTSVDAGFKLDSHHTSNLKDDPPSLSVGLASNFAPQNGPKDHIRIAPTQQQSQMTSSSLQKQFYS
HAVTGYNEFQAQMRNGRPRMDSKARSQLLPRYWPRITDQELQHLSSDSNSVITPLFEKMLSASDAGRIGRLVLPKKCAET
YFPPISQPEGLPLKVQDASGKEWIFQFRFWPNNNSRMYVLEGVTPCIQSMQLQAGDTVTFSRIDPEGKLIMGFRKATNNS
FEQEQATKPANGALATSEANGKVSAPDSSPNAAVSRQNKLNTETKSSSPVEQATALKMDKDGLTQKEGPGTGSSSPGSVK
RKTTILGQKNKRLRMDNEESMELKITWEEAQELLRPPPKAPSIVIVDGHEFEEYEEPPVLGRKTYFVADKSGSNHQWAQC
EDCSKWRKLPIDALLPSKWTCSDNKWDPERCSCESAQEISIEELAEFIPIKPAKKPKLKIESDAIDASDGLDTLANLAIL
GEGEALPSQPTTKHPRHRPGCSCIVCIQPPSGKGPKHKQTCTCNVCMTVRRRFRTLMLRREKKATKDLSRKKETGQSSEK
ATQQAVSGPPGANATATRSAQKADGNTDGPEDMAVDHKVTTSSPVKNHIDLNIQPERDDEQSPKSGAAGLLSRDNAT
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map