TFome Information for pUT6179

TFome Name:pUT6179
Genbank Insert ID:KJ728035
Protein Name:ZmbHLH105
Species: Maize
TF Family: bHLH
Template: BT056041
Corresponding TF Gene: GRMZM2G082586
Transcript: T01
Vector: pENTR/SD/D-TOPO
Note: c.A758G p.N253S. Present in template FlcDNA. Not present in functional domain.

5' Primer Name: UT3326up 3' Primer Name: UT3326dn
5' Primer Sequence: caccATGGCACTGGAGGCCGTGGTG 3' Primer Sequence: CTCTAAGCTGCCGCCGCCTTG
5' Primer Tm (º C): 67.8 3' Primer Tm (º C): 63.3
PCR Condition:
Nucleotide Sequence: ATGGCACTGGAGGCCGTGGTGCTTTCCCAGCAAGGCAGTCGCTTTGGGTGTGGTGCCATGGCAGCAGGAGGGCCTTGGAG
TGGCCTGTTTTTTAGTGGAATGGAGGGCGTGGTCGAGATCGGTAGTGGCGCTGGCGGCGGCCGGGACGTGGCCGGGTGCT
CGCCGCCACAGCTCCTGCAGGAGCCGGCTGCCCGCGCGCTGCCTGTGGCGTCGTCCGTGGGGAGCGCGAGTGGCGGCGCC
GGTCAGGATGCCCCGGCGGCACTTGCTGTGACCGCGACAGCGGCGGCCGGAACCGGAAGAAGGAAGCGGCGAAGGATGAG
GCCACTGAAGAACGAGGAGGAAGTGGAGAGCCAGCGCATGGTCCACATTGCCGTGGAGCGCAACCGGCGCAAGCAGATGA
ACGAGTACCTCGCCGCGCTCCGCTCCCTCATGCCGCCCGCCTACACGCAACGGGGCGATCAGGCGTCCATCGTCGGCGGC
GCGATCAACTTCGTCAAGGAGCTGGAGCAGCTGCTCCAGTCGCTGGAGGCGCAGCAGAGGCGTTCCTCCCGGCGGCAGGG
CCCCGCGTGCGCCGTCGATCCGGACGACGCAGGGCCGTTCGCGGACTTCTTCACCTTCCCGCAGTACTCAATGTGCGCTG
CCGCGGCGGCCCCATCAGAGAACCCCGGCGCCGACGCCGACGCCGAGCAGGAGGCGTCCGGGTCGAAGCCGTCGGGCGTG
GCCGACGTGGAGGCGACCATGGTGGAGAGCCACGCCAGCCTGCGGGTGCTGTCCCGGCGCCGGCCGAGGCAGCTGCTGCG
GCTGGTGCTGGGGCTCCAGGGCCACCGCCTCACCGTGCTCCACCTCAACATGAGCAGCGCCGGCCACATGGTGCTCTACT
CGTTCAGCCTCAAGGTGGAGGATGATTGCCCGCTCACCTCAGTGGATGAGATTGCAGGTGCGGCTCATCAGATCGTCGAG
AAGATCAACGAAGAACAAGGCGGCGGCAGCTTAGAG
TFome clones do not contain stop codon at 3'end.
Translation: MALEAVVLSQQGSRFGCGAMAAGGPWSGLFFSGMEGVVEIGSGAGGGRDVAGCSPPQLLQEPAARALPVASSVGSASGGA
GQDAPAALAVTATAAAGTGRRKRRRMRPLKNEEEVESQRMVHIAVERNRRKQMNEYLAALRSLMPPAYTQRGDQASIVGG
AINFVKELEQLLQSLEAQQRRSSRRQGPACAVDPDDAGPFADFFTFPQYSMCAAAAAPSENPGADADAEQEASGSKPSGV
ADVEATMVESHASLRVLSRRRPRQLLRLVLGLQGHRLTVLHLNMSSAGHMVLYSFSLKVEDDCPLTSVDEIAGAAHQIVE
KINEEQGGGSLE
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map