TFome Information for pUT6190

TFome Name:pUT6190
Genbank Insert ID:KJ728044
Protein Name:ZmBBR2
Species: Maize
TF Family: BBR/BPC
Template: BT064015
Corresponding TF Gene: GRMZM2G166230
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: R128F 3' Primer Name: R128R
5' Primer Sequence: caccATGGACATCACAATGCCGCACAC 3' Primer Sequence: CCTGATCGTTACAAACTTATTTGTGCCA
5' Primer Tm (º C): 63.98 3' Primer Tm (º C): 57.65
PCR Condition:
Nucleotide Sequence: ATGGACATCACAATGCCGCACACCAGCTCCACGCGCAGCAATCACAACATCATCGTGACTATGCTGGCGGCACATCCTGA
CCCGGACACAAAGCCGCCTGTAAAGAAGAGGTGGCAGGTTCGGCAGCCTAAGTCACTGAAGCCTAGGAAGCCTAAGAAGG
CTGCTGTTCCACCAGAGAATGGGGCACTTAATGAGCATGCGCCCCGAAGGAGGGGACCTAAGAAGACTGTGGGGATGGTG
ATTAATGGTATTGAGTTGGACCTTGCTAACATACCGACACCAGTGTGCTCATGCACCGGAGCTCCCCAGCAATGCTACCG
ATGGGGCGCAGGTGGCTGGCAGTCTGCATGCTGCACAACTTCTATTTCAACGTATCCACTGCCAATGAGCACAAAGCGCC
GGGGCGCTCGAATTGCTGGAAGGAAGATGAGCCAAGGTGCATTCAAAAAGGTGCTTGAGAAGCTTGCTGGCGAAGGGTAC
AACCTTGCTAATCCAATTGACTTGAAGACGTTTTGGGCTAAGCATGGCACAAATAAGTTTGTAACGATCAGG
TFome clones do not contain stop codon at 3'end.
Translation: MDITMPHTSSTRSNHNIIVTMLAAHPDPDTKPPVKKRWQVRQPKSLKPRKPKKAAVPPENGALNEHAPRRRGPKKTVGMV
INGIELDLANIPTPVCSCTGAPQQCYRWGAGGWQSACCTTSISTYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEGY
NLANPIDLKTFWAKHGTNKFVTIR
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map