TFome Information for pUT6195

TFome Name:pUT6195
Genbank Insert ID:KJ728049
Protein Name:ZmCOL12
Species: Maize
TF Family: C2C2-CO-like
Template: RT-PCR
Corresponding TF Gene: GRMZM2G041991
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: R171F 3' Primer Name: R171R
5' Primer Sequence: caccATGAGCAGCTCCAAGCACGCC 3' Primer Sequence: ACGACCTCGACACTCACGGGGACA
5' Primer Tm (º C): 66.23 3' Primer Tm (º C): 65.53
PCR Condition:
Nucleotide Sequence: ATGAGCAGCTCCAAGCACGCCGCGGGCGCCGTAGGCGGCAAGGCCGCGCGCGCCTGCGACAGCTGCCTGAGGCGGCGCGC
GCGGTGGTACTGCGCTGCCGACGACGCCTTCCTGTGCCAGGGCTGCGACGCCTCGGTGCACTCGGCGAACCCGCTCGCCA
GGCGGCACGAGCGCCTGCGCCTGCGCCCGACGGACCCGCACTCGACGACGCTCGAGGCCGGCGTGGCGACGGCGACGTGG
AAGAAGCGCCAGCAGCAGGTCGCGCCGGCGTGGTCCAAGCGCAAGGCGCGCACTCGGAGGCCGCACGTCAAGAGCGTCGG
GGAGCTCCTGTCGAGGAAGCTCGTCGTCGTGCCTGAGGTGTCCCCCATCGAATCGTCGGAGGAGCGGAAGGCCGAGGAGG
AGGAGGAAGAGGAGGAGGGGCAGCTGCTGTACTGCGTGCCGACCTTTGACCGCGCCCTGGCCGAGCTCTGCTCGCCACCG
CCTCCGGTCGATGACCCGACGGCCTCATCCTGCTGCAGGGATGACGTCGACGGCGCCGTGGAGAACAACACAAAGGCACC
ACCGGTCGTGGTCGCGGAATCGCCCGTGCAGCAGCTCCCGGACAGCTTTGCCGGCTTCGGCCCCACGGACGCCGAGCTCA
GAGAGTTCGCCGCAGACATGGAAGCCCTTCTTGGCCAGGGCCTGGACGACGGCAACGAGCTGGATAGATCGTTCTACATG
GAGAGCCTAGGGCTAATGGCGCAGCAGGCGGAAGACGTCGGCCGGATAAAGATGGAGCCCAACGGCATCGTAAGCTCCCG
CTCCCGCGGCGAGGGCGCTCCCGGGTTTGGCCCTACGGAGATGAAGCCAGAGGCGTCGTCAGCTGCTGCTGAGGTGCTGG
ACACAGACTTCAACTGCTGCTCGCCCACGGTGATGATGGATAACGAGGATGAGGACAGTTTCGAACAGAAGGCGTCGGCG
AGCAACGCTGCCGCCGCCGCCGCGGGTACGCAATTCTTGAAGAGGAGCCTGGATCTCAGCCTCAACTACGAGGCCATCAT
CGAGAGCTGGGGAAGCTCGCCGTGGACCGATGGCCAACGGCCAAGCGTCCAGCTCGACGATTTCTGGCCCCACGCCCACC
TCACGGGCTGGATGGCGGGAGGAGGACGGTTGGGTGGGGAGGCGGCGGTGACTCCACGGCTGGGGATGGGCGGCGGGCGA
GAGGCGCGGGTAACACGGTACCGGGAGAAGCGGCGGACGAGGCTGTTCGCCAAGAAGATAAGGTACGAGGTCCGGAAGCT
CAACGCGGAGAAGCGGCCGCGGATGAAGGGCCGATTCGTCAAGCGACCAGCTGCCGCTGCAGGAGGAGGAGGCGAGGAGC
TACCATTGCCGCCCCGTGCGCCGTCACCTAGCTTGCCGATCGAAGTCGCCCGTGTCGCGGCGCAGTCCCCGTGCGGCGTG
CCGATCGGGGTCAGGCCGCGCCCGTGTCCCCGTGAGTGTCGAGGTCGT
TFome clones do not contain stop codon at 3'end.
Translation: MSSSKHAAGAVGGKAARACDSCLRRRARWYCAADDAFLCQGCDASVHSANPLARRHERLRLRPTDPHSTTLEAGVATATW
KKRQQQVAPAWSKRKARTRRPHVKSVGELLSRKLVVVPEVSPIESSEERKAEEEEEEEEGQLLYCVPTFDRALAELCSPP
PPVDDPTASSCCRDDVDGAVENNTKAPPVVVAESPVQQLPDSFAGFGPTDAELREFAADMEALLGQGLDDGNELDRSFYM
ESLGLMAQQAEDVGRIKMEPNGIVSSRSRGEGAPGFGPTEMKPEASSAAAEVLDTDFNCCSPTVMMDNEDEDSFEQKASA
SNAAAAAAGTQFLKRSLDLSLNYEAIIESWGSSPWTDGQRPSVQLDDFWPHAHLTGWMAGGGRLGGEAAVTPRLGMGGGR
EARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRPAAAAGGGGEELPLPPRAPSPSLPIEVARVAAQSPCGV
PIGVRPRPCPRECRGR
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map