TFome Information for pUT6436

TFome Name:pUT6436
Genbank Insert ID:KJ728166
Protein Name:ZmbZIP64
Species: Maize
TF Family: bZIP
Template: RT-PCR
Corresponding TF Gene: GRMZM2G473274
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: CD0072_F 3' Primer Name: CD0072_R
5' Primer Sequence: caccATGTCGACGGCGCTGGCGGTGGTCG 3' Primer Sequence: CCCAGCTGGGTTATTTGCATCCCGT
5' Primer Tm (º C): 77.4 3' Primer Tm (º C): 63.4
PCR Condition: 5 l GC buffer (Thermo Fisher) 1.25 ul DMSO 100% .5 l dNTPs 10mM 14.5 l ultrapure water 0.25 l phusion taq (Thermo Fisher) 1 l primer forward 20M 1 l primer reverse 20M 1 l1 ng/lDNA template 60 sec 98°C 30x : 10 sec 98°C 30 sec 60°C 1:20 sec 72°C 10 min 72°C leave at 10°C
Nucleotide Sequence: ATGGAGGCGTTCGCGGCCCAGCATCAGGGGGACGTGTGCATGGAGGCCGTCGGCGTCGACACCGCGGCGCAGCAGGGCCC
GCGCCCGCGCACGGCGCACCGGCGCTCCCGCAGCGACGTCCCGTCCGGGTACTACTTCGGCGGCGAGGGGCACCAGCTGC
CGCCGCCCAAGGTGGAGGCCGGATGGGGCGGGCACCTCCACGGCGGCGGGGGCGACGACGACCTCTTCAACGCGTATCTC
AACCTGGAAGGGCTGGACGGGCTGAACTCCTCCGACGACCGCCGGCAGTACTACGACGGCGACAGCCGCGGGAGCAGCGT
GAGGACCAACGGCGCCGACAGCAGCGAGAACGATTCGGAGGAGTGCGCCGCCGCAGGCCCGCCCGTGGCCCACCACGTCA
GGAGCCTGTCCATGGACAGCAGCCTCATCGGCAAGCTCAACTTCTCCGCCGGCGCGGCTGCGGCCAACGGCGGCGTCATT
CCGGGGCCCAACAGGTTCAGCCTCGAGTTCGGCAGCGGCGAGTTCACCCCCGTCGAGATGAACAAGATCATGGCCGACGA
GAAGCTGGCCGAGATGGCGCTCGCCGACCCTAAGCGCGCCAAGAGGGTGCTGGCCAACAGGCAGTCGGCGGCGCGGTCCA
AGGAGCGGAAGATGCGATACATCGCGGAGCTGGAGCAGAAGGTGCAGATCCTGCAGACGGAGGCCACCGCTCTCTCCGCC
CACCTCACGCTTCTTCAGCGGGACTCCGCGGGGATCGCGACGCAGAACAACGAGCTCCAGTTCCGGCTGCAGGCCATGGC
GCAGCAGGCGCAGCTGCGTGACGCATTGAATGAGGCACTGACAGCCGAGGTCCAGCGCCTGAAACTCGCGACTGCAGAGC
TCGGCGACTCTTGCTCGTCCAACAGTCTAGCCCAGCAGATGCAGATCCAACTCAGCGCGCATGACCAGACGTTCGAACTG
CATCAGCAGCAGGCGATGCCGATAGCGTTCTACCAGCTGCGGCAGGCGCAG
TFome clones do not contain stop codon at 3'end.
Translation: MEAFAAQHQGDVCMEAVGVDTAAQQGPRPRTAHRRSRSDVPSGYYFGGEGHQLPPPKVEAGWGGHLHGGGGDDDLFNAYL
NLEGLDGLNSSDDRRQYYDGDSRGSSVRTNGADSSENDSEECAAAGPPVAHHVRSLSMDSSLIGKLNFSAGAAAANGGVI
PGPNRFSLEFGSGEFTPVEMNKIMADEKLAEMALADPKRAKRVLANRQSAARSKERKMRYIAELEQKVQILQTEATALSA
HLTLLQRDSAGIATQNNELQFRLQAMAQQAQLRDALNEALTAEVQRLKLATAELGDSCSSNSLAQQMQIQLSAHDQTFEL
HQQQAMPIAFYQLRQAQ
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis:
 
Plasmid Map