TFome Information for pUT6529

TFome Name:pUT6529
Genbank Insert ID:KJ728252
Protein Name:ZmALF5
Species: Maize
TF Family: Alfin-like
Template: RT-PCR
Corresponding TF Gene: GRMZM2G016817
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: CD0331_F 3' Primer Name: CD0331_R
5' Primer Sequence: caccATGGACCCCGGCGCC 3' Primer Sequence: GCAAAGTGACTGTCGGCG
5' Primer Tm (º C): 71.2 3' Primer Tm (º C): 62.5
PCR Condition: PCR Reaction Mix:5 l GC buffer (Thermo Fisher) 1 l primer forward 20M 1 l primer reverse 20M 1 l DNA template (c=1 ng/l) 1.25 ul DMSO 100% 1 l dNTPs 10mM 0.25 l phusion taq (Thermo Fisher) 14.5 l ultrapure water PCR program: 40 sec 98°C 30x : 15 sec 98°C 30 sec 60°C 40 sec 72°C 7 min 72°C leave at 10°C
Nucleotide Sequence: ATGGACCCCGGCGCCGGTGCACACTACTCCGCCCGTACCGCGGAGGAAGTCTTCCGCGATTTCCGCGGCCGCCGCGCGGG
CATGATCAAGGCCCTCACCAACGATGTGGAGAAGTTCTACCAGCTGTGCGACCCCGGTGAGTCTGCTCGACCTCCTCGGG
GCCGCCGACAGTCACTTTGC
TFome clones do not contain stop codon at 3'end.
Translation: MDPGAGAHYSARTAEEVFRDFRGRRAGMIKALTNDVEKFYQLCDPGESARPPRGRRQSLC
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: Erich Grotewold <grotewold.1@osu.edu>
 
Plasmid Map