TFome Information for pUT6537

TFome Name:pUT6537
Genbank Insert ID:KJ728260
Protein Name:ZmbZIP14
Species: Maize
TF Family: bZIP
Template: RT-PCR
Corresponding TF Gene: GRMZM2G153144
Transcript: T01
Vector: pENTR/SD/D-TOPO
Note: c.G319A p.A107T Not in functional domain. c.83del147 Exon 3,4 of model skipped. No evidence in RNA-seq for this transcript.

5' Primer Name: CD0061_F 3' Primer Name: CD0061_R
5' Primer Sequence: caccATGGGAAGCAATGACCCTAG 3' Primer Sequence: AGACTCGCTCCCAGGCTGGG
5' Primer Tm (º C): 65.9 3' Primer Tm (º C): 64.1
PCR Condition: 5 l GC buffer (Thermo Fisher) 1.25 ul DMSO 100% .5 l dNTPs 10mM 14.5 l ultrapure water 0.25 l phusion taq (Thermo Fisher) 1 l primer forward 20M 1 l primer reverse 20M 1 l1 ng/lDNA template 60 sec 98°C 30x : 10 sec 98°C 30 sec 60°C 1:20 sec 72°C 10 min 72°C leave at 10°C
Nucleotide Sequence: ATGGGAAGCAATGACCCTAGCACACCCTCCAAGGCTTCAAAGGCATCAAAACAAGTACTTGAAACAGTGGATCAACCTCC
AGCTACCACATCCAGTGGAACAGTTTCAGTTTACCCTGAATGGCCCAGCTTTCAGACTATGCATCCGTTTAGTCATTACC
CTATGCCAACAAATGGACATGCTGAAACTCCTGGAACCGCGCCAAGTGCTCCAGAAATGAATGGGAAAAGTGAGCCTGGC
AGAACATCTGCTCCATCTGCCAATGGGATTACCTCGCACAGTGAGAGTGGAAGTGAGAGTGAGAGTGAAGGAAGTGATGC
CAATTATGAAAATGATTCACATTCAAAGGACAATGATGGAAAGGAAGATGGCAATTCTCAGAATAGCATATCTTATTCAG
CATCACAAGGAGTGTTAAACCAAACCATGGCGATGCTTCCAATACAACCGGGCGCAATGGTTGGAGGAGTTTCTAGCTCC
ACAGCTAACTTGAATATTGGAGTGCACTACTGGGAAGCTCCAGGTTCTGCAGCTGTCTCTGCAACGCATGGCAAAGCACC
AGCTGGTTCAGCTCGGGGAGACCAATGGGATGAAAGGGAACTCAAGAAGCAAAAACGGAAGCAGTCTAATAGAGAATCGG
CACGCAGATCCCGGCTGCGCAAGCAGGCTGAGTGTGAGGAGCTTGGGCAACGTGCTGAAACTCTGAGGTCGGAAAACTCG
TCTCTCAGGGCCGAGCTTGAACGGATCAGAAAGGAGTACGAACAGCTACTTTCGCAGAACGCTTCACTCAAGGAAAAGCT
GGGGGGCAGCAGTGACCCGATTCCTGATATGAATGAACAGAACGACGGCAACGGCAGCGACAAGAAGCAATCTGATTCCG
ATGCCCAGCCTGGGAGCGAGTCT
TFome clones do not contain stop codon at 3'end.
Translation: MGSNDPSTPSKASKASKQVLETVDQPPATTSSGTVSVYPEWPSFQTMHPFSHYPMPTNGHAETPGTAPSAPEMNGKSEPG
RTSAPSANGITSHSESGSESESEGSDANYENDSHSKDNDGKEDGNSQNSISYSASQGVLNQTMAMLPIQPGAMVGGVSSS
TANLNIGVHYWEAPGSAAVSATHGKAPAGSARGDQWDERELKKQKRKQSNRESARRSRLRKQAECEELGQRAETLRSENS
SLRAELERIRKEYEQLLSQNASLKEKLGGSSDPIPDMNEQNDGNGSDKKQSDSDAQPGSES
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis:
 
Plasmid Map