TFome Information for pUT6543

TFome Name:pUT6543
Genbank Insert ID:KJ728266
Protein Name:ZmbZIP24
Species: Maize
TF Family: bZIP
Template: gDNA
Corresponding TF Gene: GRMZM2G038015
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: SE124_F 3' Primer Name: SE124_R
5' Primer Sequence: caccATGGTTCCACTGGCTGGCGCC 3' Primer Sequence: GAGCTCGAGCATACCGACGGCGTCC
5' Primer Tm (º C): 73.6 3' Primer Tm (º C): 72
PCR Condition: Step 1, 98°C 3 min melt, 1 cycle; Step 2, 98°C 40 sec melt, 72°C 60 sec extend, 35 cycles; Step 3, 72°C 7 min extend 1 cycle; 1ul Phusion (Thermo Scientific), GC buffer (Thermo Scientific), MgCl2 3 mM final concentration, 0.54M Betaine, 1.34mM DTT, 1.34% DMSO, 11ug/ml BSA, template 100ng/ul final concentration.
Nucleotide Sequence: ATGGTTCCACTGGCTGGCGCCCAGGGAGCGCGCCGCGCCGCGGTGGTCATCACGGAGGAGGAGCGGCGGCGCAACCGCAT
GACCTCCAACAGGCTGTCGGCGCGCAAGTCCCGCATGAAGCGGCAGCGGCACGTGGACGACCTGGCCGCGGAGGCGGAGC
GCCTGCGGCGCGAGAACGAGGCGATGCGCGCTGGCGTCGGCGACGCCGTGCTGCGGAGCCGCGCGCTCGAGCAGGAGAAC
CGGGTGCTCGCCGCGCACGCGCGCCAGCTGTGCGCCGCGCTCCTGCTGCGCAACTCCCAGCTCAGCCTGCTCGGCGACGT
CGCCGGCGTACCGCTCGACGTGCCGGGCGTGCCCGACCATCTCGTGCAGCTCTACGGCGGCGTGCAGGTGCCAGTCATGC
CGCTCTCGCCGTCAGTCATGCCGCTCTCGCCGTCGCCGCCGCCGCCCCTGCATCTGCAATTGCCGCTGGAGATCCAGCTG
ATGTTGCTCCAGCCCGACGTCATGGACGCCGTCGGTATGCTCGAGCTC
TFome clones do not contain stop codon at 3'end.
Translation: MVPLAGAQGARRAAVVITEEERRRNRMTSNRLSARKSRMKRQRHVDDLAAEAERLRRENEAMRAGVGDAVLRSRALEQEN
RVLAAHARQLCAALLLRNSQLSLLGDVAGVPLDVPGVPDHLVQLYGGVQVPVMPLSPSVMPLSPSPPPPLHLQLPLEIQL
MLLQPDVMDAVGMLEL
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: Erich Grotewold <grotewold.1@osu.edu>
 
Plasmid Map