TFome Information for pUT6582

TFome Name:pUT6582
Genbank Insert ID:KJ728302
Protein Name:ZmCA2P12
Species: Maize
TF Family: CCAAT-HAP2
Template: BT066676
Corresponding TF Gene: GRMZM2G104396
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: B946_F 3' Primer Name: B946_R
5' Primer Sequence: caccATGACCTCTGTTGTTCAGAGCGTT 3' Primer Sequence: TTCACGACTAGGCGCCTGATAAG
5' Primer Tm (º C): 69.1 3' Primer Tm (º C): 58.6
PCR Condition: Volumes per reaction (25l): 5 l GC buffer (Thermo Fisher) 1 l primer forward 20M 1 l primer reverse 20M 5 l glycerol 50% 1 l DNA template (c=1 ng/l) 1 l MgCl2 50mM 1 l dNTPs 10mM 0.25 l phusion taq (Thermo Fisher) 9.75 l ultrapure water Initial PCR program: 40 sec 98°C 30x : 10 sec 98°C 30 sec 60°C (prior 58°C) 30 sec 72°C 30 min 72°C leave at 10°C
Nucleotide Sequence: ATGACCTCTGTTGTTCAGAGCGTTTCAGGTGACCACAGGGCTGAGGATCAAAGTCATCAGAAGAAGCAAACTGAACCTGG
GGACCAGCAAGAAGCCCCAGTTACTAGTTCAGATAGCCAACCAACAGTGGGCACACCATCAACAGATTATGTGGCACCCT
ATGCCCCTCATGACATGAGCCATGCAATGGGTCAATATGCTTATCCAAATATTGATCCATACTATGGAAGTCTTTATGCG
GCGGCTTATGGTGGACATCCATTGATGCATCCAACATTAGTCGGAATGCATCCGGCTGGCTTACCTTTGCCTACCGATGC
AATTGAAGAGCCAGTGTATGTAAATGCAAAGCAATACAATGCCATATTAAGACGGCGTCAATCTCGGGCTAAAGCTGAAT
CAGAACGGAAGCTTGTCAAGGGCCGCAAGCCCTATCTCCATGAGTCACGGCATCAGCATGCCTTGAAAAGGGCCAGGGGA
GCTGGAGGTCGGTTTCTCAATTCGAAGTCAGATGACAAGGAAGAGAACTCCGACTCAAGTCAAAAAGAGATTCAGAACGG
AGTTGCGCCCCAAAAGGGTGGCCAACCGTCAACCCCTCCGTCTCCCAACGGTGCGTCGTCAGCTTATCAGGCGCCTAGTC
GTGAA
TFome clones do not contain stop codon at 3'end.
Translation: MTSVVQSVSGDHRAEDQSHQKKQTEPGDQQEAPVTSSDSQPTVGTPSTDYVAPYAPHDMSHAMGQYAYPNIDPYYGSLYA
AAYGGHPLMHPTLVGMHPAGLPLPTDAIEEPVYVNAKQYNAILRRRQSRAKAESERKLVKGRKPYLHESRHQHALKRARG
AGGRFLNSKSDDKEENSDSSQKEIQNGVAPQKGGQPSTPPSPNGASSAYQAPSRE
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis:
 
Plasmid Map