TFome Information for pUT6585

TFome Name:pUT6585
Genbank Insert ID:KJ728305
Protein Name:ZmCA2P8
Species: Maize
TF Family: CCAAT-HAP2
Template: BT065764
Corresponding TF Gene: GRMZM2G361842
Transcript: T02
Vector: pENTR/SD/D-TOPO

5' Primer Name: C540_F 3' Primer Name: C540_R
5' Primer Sequence: caccATGACATCTGTTGTTCACAGTGTT 3' Primer Sequence: CGACTGCCTGCCCTGATTAG
5' Primer Tm (º C): 66.6 3' Primer Tm (º C): 57.9
PCR Condition: Volumes per reaction (25l): 5 l GC buffer (Thermo Fisher) 1 l primer forward 20M 1 l primer reverse 20M 5 l glycerol 50% 1 l DNA template (c=1 ng/l) 1 l MgCl2 50mM 1 l dNTPs 10mM 0.25 l phusion taq (Thermo Fisher) 9.75 l ultrapure water Initial PCR program: 40 sec 98°C 30x : 10 sec 98°C 30 sec 60°C (prior 58°C) 30 sec 72°C 30 min 72°C leave at 10°C
Nucleotide Sequence: ATGACATCTGTTGTTCACAGTGTTTCAGGTGACCACAGGGCTGAGGATCAAAATCAACAGAAGAAGCAAGCTGAACCTGG
GGACCAGCAAGAAGCCCCAGTTACTAGTTCAGATAGCCAACCAACAGTAGGCACACCATCAACAGATTATGTGGCACCCT
ATGCCCCTCATGACATGAGCCATGCAATGGGTCAATACGCTTATCCAAATATTGACCCATACTATGGAAGCCTTTATGCA
GCAGCTTACGGTGGACAGCCATTGCCCTATCTCCATGAGTCACGTCATCAGCATGCCTTGAAAAGGGCCAGGGGAGCTGG
AGGTCGGTTTCTCAACTCAAAGTCAGATGACAAGGAAGAGAACTCCGACTCGAGTCACAAAGAGAATCAGAACGGAGTTG
CGCCCCACAGGAGCGGCCAACCGTCAACCCCTCCGTCTCCCAACGGTGCATCGTCAGCTAATCAGGGCAGGCAGTCG
TFome clones do not contain stop codon at 3'end.
Translation: MTSVVHSVSGDHRAEDQNQQKKQAEPGDQQEAPVTSSDSQPTVGTPSTDYVAPYAPHDMSHAMGQYAYPNIDPYYGSLYA
AAYGGQPLPYLHESRHQHALKRARGAGGRFLNSKSDDKEENSDSSHKENQNGVAPHRSGQPSTPPSPNGASSANQGRQS
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis:
 
Plasmid Map