TFome Information for pUT6601

TFome Name:pUT6601
Genbank Insert ID:KJ728320
Protein Name:ZmALF13
Species: Maize
TF Family: Alfin-like
Template: BT066153.1
Corresponding TF Gene: GRMZM2G080917
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: B411_F 3' Primer Name: B411_R
5' Primer Sequence: caccATGGACGGAGGAGCCGG 3' Primer Sequence: AACCTTGGCCCTCTTGCTTCCC
5' Primer Tm (º C): 69.6 3' Primer Tm (º C): 68.1
PCR Condition: PCR Conditions: Volumes per reaction (25l): 5 l GC buffer (Thermo Fisher) 1 l primer forward 20M 1 l primer reverse 20M 1.25 ul DMSO 100% 1 l 1 ng/l DNA template 1 l dNTPs 10mM 0.25 l phusion taq (Thermo Fisher) 14.5 l ultrapure water PCR program 40 sec 98°C 30x : 10 sec 98°C 30 sec 60°C 60 sec 72°C 7 min 72°C leave at 10°C
Nucleotide Sequence: ATGGACGGCGGGGGCTCCGGGCCGGCGCCCAACGCCGCGCACACCGCGGAAGAGGTCTTCCGCGACTACAAAGCCCGCCG
CGCCGGCATGATCAAGGCACTCACCACCGATGTGGAGAGGTTCTTCAAGCTCTGTGACCCCGAAAAGGAGAACTTGTGCC
TCTATGGCTATCCCGATGAGACATGGGAGGTTACCTTGCCAGCTGAGGAAGTGCCCCCAGAGATCCCTGAACCAGCATTA
GGAATCAACTTTGCTAGGGATGGCATGAATGAGAAGGACTGGCTGGCGCTAGTTGCAGTCCACAGTGATTCCTGGTTACT
ATCTGTCGCATTCTACTTTGGTGCACGGTTTGGATTTGACAGAGAAGCTAGGAGGCGGCTCTTTAGCCTGATAAACAACA
TGCCCACGATATTTGAGGTGGTGACGGGAGCAGTCAAGAAGCAGCAGGCAAAGGAGAAGACACCTAACAGTAGCAGCAAG
AGCAACAAGCCTAGTTCAAAAGTGCAGTCAAGAGCAGAGTCTCGATCGAAGGCTAAGGTCCCCAAAGACGAAGAAGAGAG
CGGTGACGACGACGGGGACGAGGAGGCGGAGGAGCACGACAACACCCTGTGTGGAACCTGCGGGACCAACGACGGCAAGG
ACCAGTTCTGGATCTGCTGCGATAACTGTGAGAAGTGGTACCATGGGAAGTGTGTCAAGATCACGCCCGCACGGGCCGAG
CATATCAAGCAGTACAAGTGCCCAGACTGCACCAACAAGAGGGTCAGGGCG
TFome clones do not contain stop codon at 3'end.
Translation: MDGGGSGPAPNAAHTAEEVFRDYKARRAGMIKALTTDVERFFKLCDPEKENLCLYGYPDETWEVTLPAEEVPPEIPEPAL
GINFARDGMNEKDWLALVAVHSDSWLLSVAFYFGARFGFDREARRRLFSLINNMPTIFEVVTGAVKKQQAKEKTPNSSSK
SNKPSSKVQSRAESRSKAKVPKDEEESGDDDGDEEAEEHDNTLCGTCGTNDGKDQFWICCDNCEKWYHGKCVKITPARAE
HIKQYKCPDCTNKRVRA
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: Erich Grotewold <grotewold.1@osu.edu>
 
Plasmid Map