TFome Information for pUT6607

TFome Name:pUT6607
Genbank Insert ID:KJ728326
Protein Name:ZmbZIP93
Species: Maize
TF Family: bZIP
Template: BT054292.1
Corresponding TF Gene: GRMZM2G050912
Transcript: T01
Vector: pENTR/SD/D-TOPO
Note: c.G325T p.G109C. Not in template FlcDNA. In functional domain. c.A419T p.Q140L. Not in template FlcDNA. In functional domain.

5' Primer Name: B525_F 3' Primer Name: B525_R
5' Primer Sequence: caccATGACCGCGGCCGACGGGGAG 3' Primer Sequence: GACGTCTGCCGGGAGGTTGAGGTCAGGGAGC
5' Primer Tm (º C): 75.9 3' Primer Tm (º C): 75.8
PCR Condition: Component 25 l Reaction Final Concentration 5X Q5 Reaction Buffer5 l1X10 mM dNTPs0.5 l200 M20 M Forward Primer.625 l0.5 M20 M Reverse Primer.625 l0.5 MTemplate DNA 1ng/l1 uL < 1,000 ngQ5 Hot Start High-Fidelity Polymerase0.25 l0.02 U/l5X Q5 High GC Enhancer (optional)(5 l)1XNuclease-Free Waterto 25 l STEPTEMPTIMEInitial Denaturation98°C30 seconds2535 Cycles98°C10 seconds*58°C10 seconds72°C20 seconds/kbFinal Extension72°C2 minutesHold410°C
Nucleotide Sequence: ATGACCGCGGCCGACGGGGAGTCCTGCGCGGTGGTCGCGACGGCCGCCGACATCATCTGCTCTCTCCGTGGTGCGGACCT
CGCCGGCTGGACCCCGCCGTGGCGCAAGCACGAGGCCGCCTGCGACGGCGTCCGTGAGGAGGAGGGCGGTGGCGGCGACG
AGGCGCGTGATCTGGCCTGGCCGGCGGTGGCGCGCGGGAAGCGCTCGCGGTCCCGGCGCGAGTCCCCGTCGGCCTCGGGC
TCCGCCGCCTCCGCCGACGCGAAGAAGAAGAAGAAGGCGAGGCGAGGGGTCCGCGGCAGCCCCGCGTCACCCCTCGACTA
CAGCTGCGTGTCCGGGTCCGGCGCGTCCACCAGCGGCGGCGAGGACGGTGCCTTCTGCTTCCAGCCAGAGCCAGCGTTCC
CGCCGGCCGCCGCGTGCCTGCTCGCGGAGCCCGCCGTGCTTCCACCCCCGCCCCCGCCCCCCAGCGAGGTGGGTGGCCTC
GCCGGACGGCGGACGATCCTCCCGGTGCCGCCACCTCGGCCCGCCGGACAGCGGGCGCGGAAGAAGATGAGGCTCCCGGA
GATCCAGCAGATGGTGCGGTCGCTGTCGGTGGAGAACGATGCCCTCCGCAAGACGATGAAGGAGCTGCAGAGGGCTTGCA
CGGCGCTGTCCCAAGAAAACGGCAAGCTAGAGACGAGGCTCGATCAGTCCACTACGCTAAACGAAGCAGTCTCCGTGGAG
AACAAGGGGAAGCCGCAGCCCCAGCGTCAGCGCGCAGCTGAGCAGGAAGCTCCGAGCGGCTTCGTGCTCCCTGACCTCAA
CCTCCCGGCAGACGTC
TFome clones do not contain stop codon at 3'end.
Translation: MTAADGESCAVVATAADIICSLRGADLAGWTPPWRKHEAACDGVREEEGGGGDEARDLAWPAVARGKRSRSRRESPSASG
SAASADAKKKKKARRGVRGSPASPLDYSCVSGSGASTSGGEDGAFCFQPEPAFPPAAACLLAEPAVLPPPPPPPSEVGGL
AGRRTILPVPPPRPAGQRARKKMRLPEIQQMVRSLSVENDALRKTMKELQRACTALSQENGKLETRLDQSTTLNEAVSVE
NKGKPQPQRQRAAEQEAPSGFVLPDLNLPADV
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: LC
 
Plasmid Map