TFome Information for pUT6620

TFome Name:pUT6620
Genbank Insert ID:KJ728339
Protein Name:ZmCADR15
Species: Maize
TF Family: CCAAT-DR1
Template: BT041097
Corresponding TF Gene: GRMZM2G064426
Transcript: T02
Vector: pENTR/SD/D-TOPO
Note: c.G367A p.V123M. c.C370G p.Q124E. In template FlcDNA. Not in functional domain.

5' Primer Name: C553_F 3' Primer Name: C553_R
5' Primer Sequence: caccATGGCGGACGCTCCG 3' Primer Sequence: GTTCGAGATATCTCCGTTATGGTACT
5' Primer Tm (º C): 68.7 3' Primer Tm (º C): 55.5
PCR Condition: Volumes per reaction (25l): 5 l GC buffer (Thermo Fisher) 1 l primer forward 20M 1 l primer reverse 20M 5 l glycerol 50% 1 l DNA template (c=1 ng/l) 1 l MgCl2 50mM 1 l dNTPs 10mM 0.25 l phusion taq (Thermo Fisher) 9.75 l ultrapure water Initial PCR program: 40 sec 98°C 30x : 10 sec 98°C 30 sec 60°C (prior 58°C) 30 sec 72°C 30 min 72°C leave at 10°C
Nucleotide Sequence: ATGGCGGACGCTCCGGCGAGCCCTGGGGGCGGAGGCGGGAGCCACGAGAGCGGGAGCCCCAGGGGCGGCGGAGGTGGAGG
CGGTGGCAGCGTCAGGGAGCAGGACAGGTTCCTGCCCATCGCCAACATCAGTCGCATCATGAAGAAGGCCATCCCGGCTA
ACGGGAAGATCGCCAAGGACGCTAAGGAGACCGTGCAGGAGTGCGTCTCGGAGTTCATCTCCTTCATCACTAGCGAGGCG
AGTGACAAGTGCCAGAGGGAGAAGCGGAAGACCATCAATGGCGACGACCTGCTGTGGGCCATGGCCACGCTGGGGTTTGA
GGACTATATTGAACCCCTCAAGGTGTACCTGCAGAAGTACAGAGAGATGGAGGGTGATAGTAAGTTAACTTCAAAATCCA
GCGATGGCTCCATTAAAAAGGATGCCCTTGGTCATGTGGGAGCAAGTAGCTCAGCTGTACAAGGGATGGGTCAGCAAGGA
ACATACAACCAAGGAATGGGTTATATGCAACCTCAGTACCATAACGGAGATATCTCGAAC
TFome clones do not contain stop codon at 3'end.
Translation: MADAPASPGGGGGSHESGSPRGGGGGGGGSVREQDRFLPIANISRIMKKAIPANGKIAKDAKETVQECVSEFISFITSEA
SDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKVYLQKYREMEGDSKLTSKSSDGSIKKDALGHVGASSSAVQGMGQQG
TYNQGMGYMQPQYHNGDISN
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis:
 
Plasmid Map