TFome Information for pUT6622

TFome Name:pUT6622
Genbank Insert ID:KJ728341
Protein Name:ZmALF19
Species: Maize
TF Family: Alfin-like
Template: BT038195
Corresponding TF Gene: GRMZM2G047316
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: B408_F 3' Primer Name: B408_R
5' Primer Sequence: caccATGGACGGCGGCGGCAC 3' Primer Sequence: TGCTCGGGCTCTCTTGCCACTACC
5' Primer Tm (º C): 73.1 3' Primer Tm (º C): 70.5
PCR Condition: PCR Conditions: Volumes per reaction (25l): 5 l GC buffer (Thermo Fisher) 1 l primer forward 20M 1 l primer reverse 20M 5 l glycerol 50% 1 l 1 ng/l DNA template 1 l MgCl2 50mM 1 l dNTPs 10mM 0.25 l phusion taq (Thermo Fisher) 9.75 l ultrapure water PCR program 1:30 at 98°C 30x : 10 sec 98°C 30 sec 60°C 60 sec 72°C 7 min 72°C leave at 10°C
Nucleotide Sequence: ATGGCCGGCCCCGTCTCCTCAGCGCCCCGGACCGTCGAGGACATCTACAAGGACTACGCCGCCCGCCGCGCCGGCCTCGT
CCGCGCTCTCACATCTGATGTCGACGGGTTCTACAGCATGTGCGACCCAGAGAAGGAGAACCTGTGCCTGTACGGTCTCC
CGAACGGCGGCTGGGAGGTATCGCTGCCGGTGGAGGAGGTGCCGCCGGAGATGCCCGAACCAGCGCTCGGGATCAACTTC
GCCAGGGACGGCATGAGGCGTCGCGACTGGCTCTCGCTCGTCGCCGTACACTCTGACGCTTGGCTCGTCTCCGTCGCATT
CTTCTTCGCCGCCAAACTCAACGGCAACGACAGGAAGCGATTATTCAACATGATTAATGATCATCCATCTGTGTATGAAA
TAATGGCTGACCGGAAGGGAAGGGAGAATAATCCTGGTGTTGATAACAGCAGCAAATCCAGGCACTCAACGAAGCGATCA
AATGATGGAAAGATAAAGAACTCAAGAGTGGCAGTTGGTGAATGTAGGTATGAGAATGATGAAGACCACAGCGAAACCCT
TTGTGGTTCTTGCAGTGGTCTCTACAACTCAAGTGAGTTCTGGATTGGATGCGACATTTGTGAGCGGTGGTTCCACGGCA
AATGTGTGAGGATAACCCCAGCAAAAGCAGAACAGATAAAGCACTACAAGTGCCCTGATTGCAGCTACAAAAAGAGCAGG
CAA
TFome clones do not contain stop codon at 3'end.
Translation: MAGPVSSAPRTVEDIYKDYAARRAGLVRALTSDVDGFYSMCDPEKENLCLYGLPNGGWEVSLPVEEVPPEMPEPALGINF
ARDGMRRRDWLSLVAVHSDAWLVSVAFFFAAKLNGNDRKRLFNMINDHPSVYEIMADRKGRENNPGVDNSSKSRHSTKRS
NDGKIKNSRVAVGECRYENDEDHSETLCGSCSGLYNSSEFWIGCDICERWFHGKCVRITPAKAEQIKHYKCPDCSYKKSR
Q
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: WL
 
Plasmid Map