TFome Information for pUT6629

TFome Name:pUT6629
Genbank Insert ID:KJ728347
Protein Name:ZmbZIP89
Species: Maize
TF Family: bZIP
Template: BT086323
Corresponding TF Gene: GRMZM2G158313
Transcript: T02
Vector: pENTR/SD/D-TOPO

5' Primer Name: C549_F 3' Primer Name: C549_R
5' Primer Sequence: caccATGGCGCAGCTGCCG 3' Primer Sequence: GTTAAAAAATGTACTAGCTAGCAGAGT
5' Primer Tm (º C): 69.9 3' Primer Tm (º C): 53.3
PCR Condition: Volumes per reaction (25l): 5 l GC buffer (Thermo Fisher) 1 l primer forward 20M 1 l primer reverse 20M 5 l glycerol 50% 1 l DNA template (c=1 ng/l) 1 l MgCl2 50mM 1 l dNTPs 10mM 0.25 l phusion taq (Thermo Fisher) 9.75 l ultrapure water Initial PCR program: 40 sec 98°C 30x : 10 sec 98°C 30 sec 60°C (prior 58°C) 30 sec 72°C 30 min 72°C leave at 10°C
Nucleotide Sequence: ATGGCGCAGCTGCCGCCGAGGGCGCCGGGGGGCGCCGCGCCGCAGGACCACTGGTCGGCGGCGGGGGAGTTCCTGGGGTT
CGCCGCGGCCAGACGCGGCGCGCACCGCCGCTCGGCGAGCGACTCGGCCGCGTTCCTCGAGGCCCTGCCCATGGAAGACG
TCATCGGCGGCGACGGCTTCGACCGCCTCGACGACGACCAGCTCATGTCCATGTTCTCCGACGTCGACGCGCCGGCCGTC
TCCGCCGGGGACGCGGCGCAGCTCATGGACGTGGCGGACGCCGACGCGGACGCGGACGACGACGGGTCGGCCGCCTCGTC
GCGCGCCGCCGCGGACGGCGTCGCCGCTGACCCCAAAAGGGTCAAGAGGTTAGTGGCAACTCTGCTAGCTAGTACATTTT
TTAAC
TFome clones do not contain stop codon at 3'end.
Translation: MAQLPPRAPGGAAPQDHWSAAGEFLGFAAARRGAHRRSASDSAAFLEALPMEDVIGGDGFDRLDDDQLMSMFSDVDAPAV
SAGDAAQLMDVADADADADDDGSAASSRAAADGVAADPKRVKRLVATLLASTFFN
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis:
 
Plasmid Map