TFome Information for pUT6637

TFome Name:pUT6637
Genbank Insert ID:KJ728355
Protein Name:ZmbZIP128
Species: Maize
TF Family: bZIP
Template: RT-PCR
Corresponding TF Gene: GRMZM2G016150
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: CD0012_F 3' Primer Name: CD0012_R
5' Primer Sequence: caccATGGAGCGCGTCTTCTCCGTGG 3' Primer Sequence: GGAGGTCGACCCCGATGAAGCC
5' Primer Tm (º C): 72.3 3' Primer Tm (º C): 64
PCR Condition: PCR Conditions: per reaction (25l): 10 l GC buffer (Thermo Fisher) 1.5 uL DMSO 1 l dNTPs 10mM 32 l ultrapure water 0.5 l Phusion HOT START II (Thermo Fisher) 2 l primer forward 20M 2 l primer reverse 20M 1 lmaize root cDNA template 60 sec 98°C 5x : 10 sec 98°C 30 sec 72°C 1:20 sec 72°C 25x : 10 sec 98°C 30 sec 65°C 1:20 sec 72°C 10 min 72°C leave at 10°C
Nucleotide Sequence: ATGGAGCGCGTCTTCTCCGTGGAGGAGATCCCCAACCCCTACTGGGTTCCGCCGCACCCTCAATCGGCGGCCGCCGGCGC
TGTTGCTGCACCAGCGGGGGAGGCGGCGGGGCTGATGAACCGGTGCCCGTCGGAATGGTACTTCCAGAAGTTCCTGGAGG
AGGCCGTGCTCGACAGCCCGGTTCCCGTAGCCGGCGTCAGTAGGGGCAGCGTTGGAGCTGGAGTTGAGGCTGCGGAGAGG
AAGACACCGGGGACCGCGGCGGCGGCGGCTGCCTCGAGCTCGGTTGTTGACCCCGTGGAGTACAACGCGATGCTCAAGCA
GAAGCTGGAGAAGGACCTCGCTGCCGTTGCCTTGTGGAGGGCTTCTGGTGCAGCACCTCCAGATAATTCTCCAGCTGGTT
CATCCTTGCCAAGTGTGGATGTTCCACATGCAGGCCCTCTTAAACCCATGGGAGGTACTGGAAGTCTAGTTCAAAACAAG
CTAGCTGGTGCTCCAGGCGGGGGATCAAGTCCACATGTAGTACAAAATGCCGATATTCCTGTTAAGCAAACCACTAGCTC
TTCCTCACGTGAGCAGTCAGACGATGATGATATGGAAGGAGATGCTGAGACTACTGGAAACGGAAACCCTGTTCAACAAA
GATTACAGAGAAGGAAGCAATCCAACCGAGAATCAGCCAGGCGTTCGAGAAGCAGAAAGGCAGCTCACTTGAATGAACTG
GAGGCACAGGTAGCACAGTTAAGAGTTGAGAACTCTTCGCTGCTAAGGCGACTTGCTGACGTTAATCAGAAGTTCAATGA
GGCTGCTGTTGACAATAGGGTGCTAAAGGCAGATGTCGAAACCTTAAGAGCAAAGGTGAAGATGGCAGAGGACTCAGTGA
AGCGGGTAACTGGCATGAACACATTGTTCCCTGCCGTGTCTGATATGTCGTCCCTCAGCATGCCATTCAATGGCTCCCCA
TCCGACTCCGCCTCTGATGCCGCCGTACCCATCCAAGATGACCTGAACAGTTACTTCGCCAATCCAAGCGAGATCGGAGG
CAGCAACGGTTACATGCCAGATATAGCTTCCTCGGCTCAAGAGGACGACGATTTCGTCAACGGGGCTCAGGTCGCCGGCA
AGATGGGCAGCACTGACTCGCTGCAGCGGGTGGCGAGCCTGGAGCACCTCCAGAAGAGGATGTGCGGAGGCCCGGCTTCA
TCGGGGTCGACCTCC
TFome clones do not contain stop codon at 3'end.
Translation: MERVFSVEEIPNPYWVPPHPQSAAAGAVAAPAGEAAGLMNRCPSEWYFQKFLEEAVLDSPVPVAGVSRGSVGAGVEAAER
KTPGTAAAAAASSSVVDPVEYNAMLKQKLEKDLAAVALWRASGAAPPDNSPAGSSLPSVDVPHAGPLKPMGGTGSLVQNK
LAGAPGGGSSPHVVQNADIPVKQTTSSSSREQSDDDDMEGDAETTGNGNPVQQRLQRRKQSNRESARRSRSRKAAHLNEL
EAQVAQLRVENSSLLRRLADVNQKFNEAAVDNRVLKADVETLRAKVKMAEDSVKRVTGMNTLFPAVSDMSSLSMPFNGSP
SDSASDAAVPIQDDLNSYFANPSEIGGSNGYMPDIASSAQEDDDFVNGAQVAGKMGSTDSLQRVASLEHLQKRMCGGPAS
SGSTS
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: Erich Grotewold <grotewold.1@osu.edu>
 
Plasmid Map