TFome Information for pUT6640

TFome Name:pUT6640
Genbank Insert ID:KJ728358
Protein Name:ZmCA2P13
Species: Maize
TF Family: CCAAT-HAP2
Template: RT-PCR
Corresponding TF Gene: GRMZM5G857944
Transcript: T02
Vector: pENTR/SD/D-TOPO

5' Primer Name: CD0408_F 3' Primer Name: CD0408_R
5' Primer Sequence: caccATGCTTCTTCCCTCTTCGTCTTC 3' Primer Sequence: TCTCATAACTGGAACCCTATGCTG
5' Primer Tm (º C): 67.4 3' Primer Tm (º C): 63.1
PCR Condition: 5 l GC buffer (Thermo Fisher) 0.6 l primer forward 20M 0.6 l primer reverse 20M 1 l DNA template (c=1 ng/l) 0.5 l dNTPs 10mM 0.2 l phusion taq (Thermo Fisher) 17.1 l ultrapure water PCR program: 30 sec 98°C 30x : 10 sec 98°C 30 sec 63°C 30 sec 72°C 7 min 72°C leave at 10°C
Nucleotide Sequence: ATGCTTCTTCCCTCTTCGTCTTCGTCTTCCGCTTCCGCTTCCAAAGGTAACTCCTTTGGGAAAACCGTTAACGATCATCT
GAGGTCAACTTTGAGTTTTGATAACAAGCAACCTCCATTTGCGAGTCAAAACTTTGACTACGGTCAAACAATAGCTTGCA
TTTCATACCCGTACAATCGTTCTAGATCAGGAGATGTTTGGGCAGCCTATGAGTCACGCACCAGCACTGCCACTGTGTTC
CGTTCCCAAATTGCTGGTGGGGGTTCATCCACAAGAATTCCCTTGCCTTTGGAATTAGCAGAGAATGAACCCATATATGT
GAATCCCAAACAATATCACGGGATACTTCGCAGAAGACAGTTACGTGCCAAGCTAGAGGCTCAGAACAAGCTAGTCAGAG
CCCGAAAGCCTTACCTTCATGAGTCTAGGCATCTTCATGCAATGAAGAGGGCACGAGGTTCCGGTGGACGATTCCTCAAC
ACTAAGCAGCTCCAGCAGTCTCACACAGCCCTCACCAGGTCCACCACCACAAGTGGCACAAGCTCCTCAGGCTCAACTCA
TCTGCGGCTTGGTGGTGGCGCAGCCGCAGCTGGAGATCGATCTGTGCTGGCACCCAAAACAATGGCCTCACAAGACAGTA
GCAAGAAGGCCGTTTCTTCAGCCCTCGCCTTCACTGCGACTCCAATGCTGCGCAGAGATGACGGCTTCTTGCAGCACCCA
AGCCATCTTTTCAGTTTTTCTGGTCATTTTGGGCAGGCAAGCGCGCAAGCTGGCGTCCATAATGGAAGTCAGCATAGGGT
TCCAGTTATGAGA
TFome clones do not contain stop codon at 3'end.
Translation: MLLPSSSSSSASASKGNSFGKTVNDHLRSTLSFDNKQPPFASQNFDYGQTIACISYPYNRSRSGDVWAAYESRTSTATVF
RSQIAGGGSSTRIPLPLELAENEPIYVNPKQYHGILRRRQLRAKLEAQNKLVRARKPYLHESRHLHAMKRARGSGGRFLN
TKQLQQSHTALTRSTTTSGTSSSGSTHLRLGGGAAAAGDRSVLAPKTMASQDSSKKAVSSALAFTATPMLRRDDGFLQHP
SHLFSFSGHFGQASAQAGVHNGSQHRVPVMR
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis:
 
Plasmid Map