TFome Information for pUT6727

TFome Name:pUT6727
Genbank Insert ID:KJ728422
Protein Name:ZmBSD3
Species: Maize
TF Family: BSD
Template: RT-PCR
Corresponding TF Gene: GRMZM5G870572
Transcript: T02
Vector: pENTR/SD/D-TOPO
Note: c.C297A p.(=)

5' Primer Name: 3' Primer Name:
5' Primer Sequence: 3' Primer Sequence:
5' Primer Tm (º C): 3' Primer Tm (º C):
PCR Condition:
Nucleotide Sequence: ATGGGGTCCATGACGATCGGTGCCAAGTACAAGACCACGATCAAGGACCCCGGCACCCCGGGCATCCTCCGCATGAACGG
TGATAGGTTCACCTTCACCCCTAATGATCCACGATCGGCAATGAAGTTCAATGTTGATTTCCGAACCATCAAAGGTCACA
AGTTCAATAAAGTAGAGGGTAACAAAGCAGCATTATTGAACCTTTCAAAAGAAGACAAGGCTGGAGGCTACATATTTGAG
TTTGACAATGTTGGTAACCGTGACCAATGTCGAGACTTTGTAGCTAGGGTTTTAGGAAAACATCAAGGGATAGTGCCTCC
TAGACCAACTGTGGCTCCTGAAAACTCAGTTGCTTCTGCTGCTCTGGAACAACTCAGTGCCGCAGAAGTGGAGAGACGGG
TTAAACTGTTGCGAGAAGACAGCGAATTGCAGAAATTACATAAGAAGTTTGTTCTTGGAAATATTCTGCAAGAATCTGAA
TTTTGGGCAACAAGAAAGAATTTACTTGATGATGAAGCAAATAAGAGATCAAAACAAAAGCCAGGTTTCAAGAGTGCACT
TGTAGATATTAGGCCAACAACTGATGGTCGGACAAACAAGGTTACTTTCCAGATCACACCTGAGATGATACATCAGATTT
TTGCAGAAAAGCCTGCTGTCCGTAGAGCATATTTAGATTTTGTTCCAAAAAAGATGTCAGAAACCCGATTTTGGGAAAAA
TACTGTAGAGCTGAGTATCTAGTCAGGACAAAAAACACTGCAGCAGCAACAGCTGAGGCAGCTGGAGATGAGGAATTAGC
TATCTTCCTGAAGAATGATGATATACTGGCCAAGGAGGCAAAGTTGAAGATAAAACGAGTCGATCCAACATTAGACATGG
AGGCAGACACTGGAGATGATTACATTCATCTTCCGGACCATGGGATTCACCGTGATGGTAGCAAAGAGACAGTCGATGCT
GACAGTGAGTTGGCGAGGAGGACGCTGTCTCAGGACCTGAACCGTCATGCAGCTGTTGTTCTTGAAGGGAGATCTCTTGA
TGTTGAGTCAACTGATCCAAAGACTTTAGCTGAAGCCCTTGCAAGATCCAAGAAAGAACCACCTTCTACTTCTAATGTTG
ATGATGATAATCATGAGAGACTAATGAAGGTGGCTAGAATGACAGAGATAGAGGATCTGCAAGCTCCACGAAGTCTTCTG
TATGCACCACTTTGTATAAAGGATCCTAGAGAATATTTTGATTCCCAACAAGCAAATGCTCTGAGATCTCTAGGTGGCAG
CAATGGTGGAAGAAAAGCCCATAGTTGCAGCTTGAGCACTGAAGAAGTGTTCCATCATTTAATGGATCAAATGTCTTCTG
TTAAAGTTAATAGGCTTAACTGTCCGATTGTTCAGTCTGATATGGCTCTTAAGGTTCTTAATGAATTAAACGAAGGGATT
TCTCGTTCAAGGAGACTTAACCTCAAGAATCCTCAAGAAGGTCTCCTTGGTCAGCTGCCTCAACATACACGGGACGAGCT
TATGGATCATTGGACGGCTATCCAGGAATTGCTACGCCATTTTTGGTCATCGTATCCAATAACAAGTGCAGTACTTTATA
ACAAGGTTCAAAGAGTTAAAGAAGCTATGACACAGATATATCAAAAGCTGCAGCTTATAAAGGAATTGGCACAGCCTGAT
GTAAGACATGAAATATCTCGGCTAGTAAAGCCCATGACTCAGGCCTTGGATGCCGCCTTCAACCATGATTTGGAACAGCA
GCAGAAATCGTCCAAGGCCGGAAACAGGCACAACGGGTTT
TFome clones do not contain stop codon at 3'end.
Translation: MGSMTIGAKYKTTIKDPGTPGILRMNGDRFTFTPNDPRSAMKFNVDFRTIKGHKFNKVEGNKAALLNLSKEDKAGGYIFE
FDNVGNRDQCRDFVARVLGKHQGIVPPRPTVAPENSVASAALEQLSAAEVERRVKLLREDSELQKLHKKFVLGNILQESE
FWATRKNLLDDEANKRSKQKPGFKSALVDIRPTTDGRTNKVTFQITPEMIHQIFAEKPAVRRAYLDFVPKKMSETRFWEK
YCRAEYLVRTKNTAAATAEAAGDEELAIFLKNDDILAKEAKLKIKRVDPTLDMEADTGDDYIHLPDHGIHRDGSKETVDA
DSELARRTLSQDLNRHAAVVLEGRSLDVESTDPKTLAEALARSKKEPPSTSNVDDDNHERLMKVARMTEIEDLQAPRSLL
YAPLCIKDPREYFDSQQANALRSLGGSNGGRKAHSCSLSTEEVFHHLMDQMSSVKVNRLNCPIVQSDMALKVLNELNEGI
SRSRRLNLKNPQEGLLGQLPQHTRDELMDHWTAIQELLRHFWSSYPITSAVLYNKVQRVKEAMTQIYQKLQLIKELAQPD
VRHEISRLVKPMTQALDAAFNHDLEQQQKSSKAGNRHNGF
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis:
 
Plasmid Map