TFome Information for pUT1137

TFome Name pUT1137
Genbank Insert ID HQ858681
Protein Name ZmMYB22
Species Maize
TF Family MYB
Gene ID GRMZM2G096358
transcript T01
Vector pENTR/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: C17 UP 3' Primer Name: C17 DN
5' Primer Tm (º C): 60.0 3' Primer Tm (º C):
5' Primer Sequence: caccATGTCCCAGAGGAAAGGC 3' Primer Sequence: GATACCTCCTCTCCATTGatgc
PCR Condition: Step 1, 98C 30 sec melt, 1 cycle; Step 2, 98C 10 s
Nucleotide Sequence: ATGTCCCAGAGGAAAGGCGCCATGGCGGCTGCAGTGACGGCCAGCAAGCATCGCGAGGACCAGGAGGCGATGATGGTGGAGCTCAGGAGAGGCCCCTGGACGCTCGAGGAAGACAACCTCCTCATGAACTACATTGCTTGCCACGGCGAGGGCCGCTGGAATCTCCTCGCCCGCTGCTCCGGGTTGAAGAGGACCGGCAAGAGCTGCCGGCTCAGGTGGCTCAACTACCTGAAGCCCGACATCAAGCGCGGCAACCTGACGCCTGAGGAGCAGCTGCTCATCCTCGAGCTCCACTCCAAGTGGGGGAACAGGTGGTCGAGGATAGCGCAGCACCTGCCGGGGCGCACCGACAACGAGATCAAGAACTACTGGCGGACGCGCGTGCAGAAGCAGGCGCGGCAGCTGCGGGTGGACGCCAACAGCGCCGTCTTCCGCGACGCCGTCCGCTGCTACTGGATGCCGCGCCTGCTGGAGAAGATGGCCGCGCACCACCACGGCGACGGCGAGCTGCCGCCGCCACTGCACCCCTCGCACAACATCGCCGGCACGGCCTCCTCGCGCTCGCCGCCGGCCCACGGCAGCCAGCAGGAGGACCCGAGTAGTAGCGCGCCGGCGGCCAGCGGCCACTACCTGCAGCAGGTCGACCCGAGCCCGAGCACGTCGACGACGTCCGGGTCGACGACCTCGGCCGCGCTCCCGCCGGTGCCCTGCTTCTCCGAATCCGAACTAAGGTGGGTCGTGGACCAGTACGGCGCCGCTTACGGTTACACCGACGACCTCGACCTCGACGGCGGCGCCGGCGTGGTCGACGACGACTCGGCTGCCGCCGCCGCGCTGGACAGCCTCGGGCTGGACGGGCTGGACCTGGGGCCCGCCGACGGCGGCGTGTACTCGGACGCGACGCTGCTGGACTACCTCAACGCCACGTGCGCCGGCGGCACCACCGTGATGACAATGATGGGCGGCGTCCACGGCGCCGCGGGCGGTGGCGACGGCGACTACGGTCCGTCGCCGTGGCGGACGGACGAGCTCGGCCAGACGGCGAGGAAGCTCGGCGATCCTCAGCATCAATGGAGAGGAGGTATC
TFome clones do not contain stop codon at 3'end.
translation: MSQRKGAMAAAVTASKHREDQEAMMVELRRGPWTLEEDNLLMNYIACHGEGRWNLLARCSGLKRTGKSCRLRWLNYLKPDIKRGNLTPEEQLLILELHSKWGNRWSRIAQHLPGRTDNEIKNYWRTRVQKQARQLRVDANSAVFRDAVRCYWMPRLLEKMAAHHHGDGELPPPLHPSHNIAGTASSRSPPAHGSQQEDPSSSAPAASGHYLQQVDPSPSTSTTSGSTTSAALPPVPCFSESELRWVVDQYGAAYGYTDDLDLDGGAGVVDDDSAAAAALDSLGLDGLDLGPADGGVYSDATLLDYLNATCAGGTTVMTMMGGVHGAAGGGDGDYGPSPWRTDELGQTARKLGDPQHQWRGGI