TFome Information for pUT1148

TFome Name pUT1148
Genbank Insert ID HQ858692
Protein Name ZmMYB8
Species Maize
TF Family MYB
Gene ID GRMZM2G041415
transcript T01
Vector pENTR/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: D2 UP 3' Primer Name: D2 DN
5' Primer Tm (º C): 63.6 3' Primer Tm (º C):
5' Primer Sequence: CAC CAT GGG GAG GTC GCC G 3' Primer Sequence: GCTCTCACTCCCTTGGCCA
PCR Condition: Step 1, 98C 30 sec melt, 1 cycle; Step 2, 98C 10 s
Nucleotide Sequence: ATGGGGAGGTCGCCGTGCTGCGAGAAGGCGCACACGAACAAGGGCGCCTGGACCAAGGAGGAGGACCAGCGGCTCGTCGCCTACATCAAGGCCCACGGCGAAGGCTGCTGGAGGTCGCTCCCCAAGGCCGCGGGCCTGCTGCGCTGCGGCAAGAGCTGCCGCCTCCGGTGGATCAACTACCTGCGCCCCGACCTCAAGCGCGGCAACTTCACCCAGGAGGAGGACGACGTCATCATCAAGCTCCACCAGGTCCTCGGAAACAAGTGGTCGCTGATCGCCGCCCAGCTGCCGGGGCGGACGGACAACGAGATCAAGAACTACTGGAACACGCACATCAAGCGCAAGCTCATCGCCCGGGGCATCGACCCACGGACGCACCAGCCGGCGAGTGCCGCCGCAGTTGCCCCCGCCGCCGCCGCCGCCGCCGCCGCGCAAAGCAGCTTTCGCCACCATGGCGACGACGAGGCGGTGGCGCGGCGCAGCTGCTCGCGAGACAGCGGCTGCATCGCGGCGCACAGCAGCGACGACGACGACAGCACGTCCGGGTCCCTGCCACACCAACATGCTGTCGGCGGCATCGACCTCAACCTCTCGCTAAGCCCACCGACGAGCCAACCGTCATCGCCGGCCGCCGCCAAGGGAGTTGTAGCTAGCGGATATGGCCAAGGGAGTGAGAGC
TFome clones do not contain stop codon at 3'end.
translation: MGRSPCCEKAHTNKGAWTKEEDQRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFTQEEDDVIIKLHQVLGNKWSLIAAQLPGRTDNEIKNYWNTHIKRKLIARGIDPRTHQPASAAAVAPAAAAAAAAQSSFRHHGDDEAVARRSCSRDSGCIAAHSSDDDDSTSGSLPHQHAVGGIDLNLSLSPPTSQPSSPAAAKGVVASGYGQGSES