TFome Information for pUT1151

TFome Name pUT1151
Template Full-length cDNA
FlcDNA
Genbank Insert ID HQ858695
Protein Name ZmMYB95
Species Maize
TF Family MYB
Gene ID GRMZM2G051528
transcript T01
Vector pENTR/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: E1 UP 3' Primer Name: E1 DN
5' Primer Tm (º C): 64.7 3' Primer Tm (º C):
5' Primer Sequence: CAC CAT GGG GAG GGC GCC 3' Primer Sequence: GAGATTGTCGAGGAAGAAgaggt
PCR Condition: Step 1, 98C 30 sec melt, 1 cycle; Step 2, 98C 10 s
Nucleotide Sequence: ATGGGGAGGGCGCCGTGCTGCGGGAAGGTGGGGTTGAAGAAGGGGAGGTGGACCAGGGAGGAGGACGAGATCCTGGCGAGGTACATCGAGGAGCACGGGGAAGGCTCATGGAGATCACTGCCCAAGAATGCTGGGTTGCTGCGGTGCGGGAAGAGCTGCAGGCTGCGGTGGATCAACTACCTGAGGGCGGGTCTCAAGAGGGGGAACATCACGGAGGAGGAGGAGGACGTGATCGTCAAGCTTCACGCCACGCTTGGCAACAGGTGGTCCCTGATCGCCGGTCATTTGCCTGGCCGAACTGACAACGAGATCAAGAACCACTGGAACTCGCACCTGCGCAGGCGCGGGCGGGCGGGCGACTCCCGCGACGACGGCGTCGTCGTCAACATCGACCTCGTCAAGCTGCCCGGCGGCCGCCGGGCCAGCAGCCGAGGCATCGTGGCCGCGGCCAAGCCAGCTGGAAAGAACAAGGAGAAGAGGAAGAACGGCAAGGGCAGGAACAACGTAGCAGAAGCGGAGCAGCAGCTCGAGGAGGAGGACGCCAACGTGTCAACAACTACGCCGAGGACTCAGTCTCACTGCGCCTCCGCTGCCCAGAGCGAGGAGCAAGCGCAGGCCAGCGCTAGCGGCCTGACCTCCGAGGAGGACCTGCTGGCCCTGAGCGAGGAGATGGTGGTGAGTGCGCTACTGGCCCCGGGAAGCCCGAAGCTGCTGGAGGTGGGCCCCGACGGCTCGTGCGTGGACGGTGACGGTGGCCTGTCTGGGGACAGCGGCCGTGGGTCAGGCGGGCCTTCTGGCGATGTGGCCCAGGAGCTGCACCTCGACGACGACGCCATCATGGACTGGGACTCCATGGGGCTGGACATCCCGACCGCCGATGACACGTGGAACCCCCTGGTGTGGGACTACGACCAGACGTCGTTGGTCCCGGAACCGGAAGGAGAGGGGCGCCGGCAGCGGGACGAGATGATGTCAGACCTCTTCTTCCTCGACAATCTC
TFome clones do not contain stop codon at 3'end.
translation: MGRAPCCGKVGLKKGRWTREEDEILARYIEEHGEGSWRSLPKNAGLLRCGKSCRLRWINYLRAGLKRGNITEEEEDVIVKLHATLGNRWSLIAGHLPGRTDNEIKNHWNSHLRRRGRAGDSRDDGVVVNIDLVKLPGGRRASSRGIVAAAKPAGKNKEKRKNGKGRNNVAEAEQQLEEEDANVSTTTPRTQSHCASAAQSEEQAQASASGLTSEEDLLALSEEMVVSALLAPGSPKLLEVGPDGSCVDGDGGLSGDSGRGSGGPSGDVAQELHLDDDAIMDWDSMGLDIPTADDTWNPLVWDYDQTSLVPEPEGEGRRQRDEMMSDLFFLDNL