TFome Information for pUT1157

TFome Name pUT1157
Genbank Insert ID HQ858701
Protein Name ZmMYB50
Species Maize
TF Family MYB
Gene ID GRMZM2G145444
transcript T01
Vector pENTR/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B33 UP 3' Primer Name: B33 DN
5' Primer Tm (º C): 61.4 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGAGTGGAGTCGGAG 3' Primer Sequence: CGGCCGTGTGACGACGCC
PCR Condition: Step 1, 95C 4 min melt, 1 cycle; Step 2, 95C 30 se
Nucleotide Sequence: ATGGGAGTGGAGTCGGAGTGCGACAGGATAAAGGGCCCCTGGAGCCCCGAGGAGGACGAGGCGCTGCGGCGTCTCGTGGAGCGCCACGGCGCGCGGAACTGGACGGCGATCGGGCGCGGCATCCCGGGGCGGTCGGGGAAGTCGTGCCGGCTGCGGTGGTGCAACCAGCTGTCGCCGCAGGTGGAGCGCCGCCCCTTCACGCCCGAGGAGGACGCCGCGATCCTGGCCGCGCACGCCCGGCTGGGCAACCGGTGGGCCGCCATCGCGCGCCTTCTCCCGGGGCGCACCGACAACGCCGTTAAGAACCACTGGAACTCGTCGCTCAAGCGGAAGCTCGCCACCGCCACGGCGACCTCCAGCGGCAGCGATGCTGAGCGGGCGTGCAAGCGCGCAAGCCCTGGCCCGGGGAGCCCGACGGCGTCGGACCGCAGCGACCTCAGCCACGGCTGCGGCGCCGCGCAGGTGTTCCGTCCCGTCCCGCGCGCCGGAGGCTTCGACGCCATCAGCGCCGCAGACGTGCGCCCTCCGCCCCCGCCAGCAGTCGCAGACGAGGACCCGCTCACCTCGCTCTCCCTCTCGCTGCCGGGGCTGGACCAGTCGCCGTCGGGCTTCCACCACGACAGCGCCCGGAGCCACTTCCAGGAGCTCTCCCCCTCGTCGTCCCCGTCGCCGCAGTCTACTCCACCCGCCTTCCCTCCGCAGGCGGCTCCGTCTCAGTCGTCGTACGCGTTCAGCGGCGAGCTGGTTGCCGCGATGCAGGAAATGATCCGCGCCGAGGTGCGCAAGTACATGTCCGGCGCGGGGCTCCGCGCCGGATGCGGGCCCGGGGCCGTGGGCGAGGTGTGCATGCCGCAGCTGGTGGAGGGTGTGATGCGCGCCGCCGCGGAGCGCGTCGGCGTCGTCACACGGCCG
TFome clones do not contain stop codon at 3'end.
translation: MGVESECDRIKGPWSPEEDEALRRLVERHGARNWTAIGRGIPGRSGKSCRLRWCNQLSPQVERRPFTPEEDAAILAAHARLGNRWAAIARLLPGRTDNAVKNHWNSSLKRKLATATATSSGSDAERACKRASPGPGSPTASDRSDLSHGCGAAQVFRPVPRAGGFDAISAADVRPPPPPAVADEDPLTSLSLSLPGLDQSPSGFHHDSARSHFQELSPSSSPSPQSTPPAFPPQAAPSQSSYAFSGELVAAMQEMIRAEVRKYMSGAGLRAGCGPGAVGEVCMPQLVEGVMRAAAERVGVVTRP