TFome Information for pUT1165

TFome Name pUT1165
Template DR814848
Genbank Insert ID HQ858709
Protein Name ZmMYB132
Species Maize
TF Family MYB
Gene ID AC206901.3_FG005
transcript T005
Vector pENTR/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B21 UP 3' Primer Name: B21 DN
5' Primer Tm (º C): 67.0 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGGAGGGCTCCGTGC 3' Primer Sequence: GCCAGGGAACTGAAAATT
PCR Condition: Step 1, 98C 30 sec melt, 1 cycle; Step 2, 98C 10 s
Nucleotide Sequence: ATGGGGAGGGCTCCGTGCTGCGAGAAGATGGGGCTCAAGAGGGGGCCATGGACGCCGGAGGAGGACAAGATCCTGGTCGCGCACATCCAGAGCTTCGGCCACAGCAACTGGCGCGCGCTGCCCAAGCAAGCCGGGCTGCTGCGGTGCGGCAAGAGCTGCCGGCTCCGGTGGATCAACTACCTGCGCCCGGACATCAAGCGCGGCAACTTCAGCAAGGAGGAGGAGGACGCCATCATCACCCTCCACGAGCAGCTCGGCAACAGGTGGTCCGCCATCGCCGCCAGGCTGCCCGGGCGGACGGACAACGAGATCAAGAACGTCTGGCACACGCACCTCAAGAAGCGGCTGGAGCCCACCACCAAGCAGCTGGAGCAGGAGCAGCACGGGGCGCATGCAGGTGGTGGCGCCGCCAGGAAGCGCAGCAGGCCCAAGCGCGCGGGTGCCAGGAAGACGACGACGGCCGCCGTCGCCCCGGCCACCACCGCGCCGGCGTCGCCTGAACGGTCGGCGGCCTCGTCGTCGGTGACCGAGTCGACGGAGCAGGAGCAGGGAAACACGGGGACGAGCTCGCCCGGGTTCCCCAAGGAGGAGAGCTTCACCTCGTCCTCGGAGGCCGCCGAGGAGTTCCAGTTCGACGACACGTTCTGGTCGGAGACGCTGTCCATGCCGCTGGACAGCTTCGACGACGTCCCCATGGAGCCCTGCTCCGGCGCGTTCGGCGACGTGGCCGCCTCCTCCTCCTCGTCGTCCGTTGGCGCCGACGCCGACTTGGACTACTGGCTCGGAGTGTTCATGAAGTCCGGCGACGCGCACCAACAACTGCCGCAGGTT
TFome clones do not contain stop codon at 3'end.
translation: MGRAPCCEKMGLKRGPWTPEEDKILVAHIQSFGHSNWRALPKQAGLLRCGKSCRLRWINYLRPDIKRGNFSKEEEDAIITLHEQLGNRWSAIAARLPGRTDNEIKNVWHTHLKKRLEPTTKQLEQEQHGAHAGGGAARKRSRPKRAGARKTTTAAVAPATTAPASPERSAASSSVTESTEQEQGNTGTSSPGFPKEESFTSSSEAAEEFQFDDTFWSETLSMPLDSFDDVPMEPCSGAFGDVAASSSSSSVGADADLDYWLGVFMKSGDAHQQLPQV