TFome Information for pUT1186

TFome NamepUT1186
Genbank Insert IDHQ858808
Protein NameOsCA5P14
Species Rice
TF Family CCAAT-HAP5
Gene ID LOC_Os07g36140
transcript
Vector
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 0.0 3' Primer Tm (º C): 0.0
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGGCCGGGAGAGGGAAGGCGATCGGCTCGGGCGCCGCCAAGAAGGCCATGTCGCGGAGCTCCAAGGCCGGGCTCCAGTTCCCCGTGGGCAGGATCGCCCGGTTCTTGAAGGCCGGCAAGTACGCCGAGAGGGTCGGCGCCGGCGCCCCGGTCTACCTCGCCGCCGTCCTCGAGTACCTCGCCGCTGAGGTTCTTGAGCTCGCCGGGAACGCGGCGAGGGACAACAAGAAGACCCGCATAGTGCCCCGCCACATCCAGCTCGCCGTCCGCAACGACGAGGAGCTATCCCGCCTGCTCGGCACGGTCACAATCGCCAGCGGAGGCGTCATGCCCAACATCCACAACCTGCTCCTCCCCAAGAAGGCCGGCGGCAGCGCCAAGGCGGCGGCCGGCGACGATGACAAC
TFome clones do not contain stop codon at 3'end.
translation: magrgkaigsgaakkamsrsskaglqfpvgriarflkagkyaervgagapvylaavleylaaevlelagnaardnkktrivprhiqlavrndeelsrllgtvtiasggvmpnihnlllpkkaggsakaaagdddn