TFome Information for pUT1189

TFome Name pUT1189
Template EB167101
Genbank Insert ID HQ858722
Protein Name ZmMYB91
Species Maize
TF Family MYB
Gene ID GRMZM2G119693
transcript T01
Vector pENTR/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B57 UP 3' Primer Name: B57 DN
5' Primer Tm (º C): 62.3 3' Primer Tm (º C):
5' Primer Sequence: CAC CAT GGG ACG GCT CTC CTG 3' Primer Sequence: GAAGTATTCCAAATTGAATTctatg
PCR Condition: Step 1, 98C 30 sec melt, 1 cycle; Step 2, 98C 10 s
Nucleotide Sequence: ATGGGACGGCTCTCCTGCGGCGGCGTGCAGCCCAAGCTCCGCAAGGGGCTGTGGTCGCCCGAGGAGGACGAGAGGCTGTACGGTCACATCATTCGACACGGCGTCGGCTGCTGGAGCTCTGTCCCTAAGCTCGCAGGGCTGCAGCGCTGCGGCAAGAGCTGCCGCCTGCGGTGGATCAACTACCTCCGCCCCGACCTCAAGCGCGGCGGCTTCTCGCAGCAGGAGGAGGACCTCATCGTCGCGCTCCACGAGATCCTGGGGAACAGGTGGTCGCAGATCGCGTCGCACTTGCCGGGGCGGACGGACAACGAGATCAAGAACCTGTGGAACAGCTGCCTCAAGAAGAAGCTCCGGCAGCGCGGCATCGACCCGGCCACGCACAAGCCGATCGCCGCGGAGGCGGGCTCGGCGCCGCTGCACCGCGACGACCAGAGCAAGCCGCAGCAGCAGCCTGCGGCGGCGGCCGTGTTCGACCCGTTCCCGGTGACCGACTTCGGCTTCGACCTGGGCGCGGCGGCATTGTACGGCGACGACGTCGGCGGCGACGCGTCGTCGGACGCCGGGTTCTTGGCCGACTACAGCAGCGTGCTGGACGTGTCGGAGAACCTGGGCTACGGGGAGAGCTCCAGCAACAGCAGCGGCTGGAACTGCGCGGAGATGGGCAATGCCGTGCTCGACAGCGAGGCGCTGCACTGGACCTCAGCCGCCGCCGCTGCCGCCACCAAGCCGGAGCCCTGCTCGGAGCTGGAGCAGCAGCGCAGCGGAGGATTGAGTTCAGAAGTGTTCAACATAGAATTCAATTTGGAATACTTC
TFome clones do not contain stop codon at 3'end.
translation: MGRLSCGGVQPKLRKGLWSPEEDERLYGHIIRHGVGCWSSVPKLAGLQRCGKSCRLRWINYLRPDLKRGGFSQQEEDLIVALHEILGNRWSQIASHLPGRTDNEIKNLWNSCLKKKLRQRGIDPATHKPIAAEAGSAPLHRDDQSKPQQQPAAAAVFDPFPVTDFGFDLGAAALYGDDVGGDASSDAGFLADYSSVLDVSENLGYGESSSNSSGWNCAEMGNAVLDSEALHWTSAAAAAATKPEPCSELEQQRSGGLSSEVFNIEFNLEYF