TFome Information for pUT1193

TFome NamepUT1193
Genbank Insert IDHQ858813
Protein NameOsbZIP42
Species Rice
TF Family bZIP
Gene ID LOC_Os05g41070
transcript
Vector
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 0.0 3' Primer Tm (º C): 0.0
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGATTCAGGCAATGGCTTCGCATGCTGGAGGTAGTGGCGGCGGCGGCGGTGGAAGTGGCCGGGATGCTGGCTCGGCGCAGCGCGGGCCGATGCAGGGGTTGGCGAGGCAAGGGTCGCTGTATGGGCTTACACTCAATGAGGTTCAGAGCCAGTTGGGGGAGCCGTTGCTTAGTATGAACCTTGATGAGCTGCTTAAAAGCGTGTTTCCTGATGGCGCGGACCTTGACGGTGGCGGTGGCGGTGGCGGCATCGCGGGCCAGTCTCAGCCGGCCCTGGGGCTGCAGCGCCAGGGGAGCATCACGATGCCTCCGGAGCTGAGCAAGAAGACGGTGGATGAGGTGTGGAAGGGCATCCAGGATGTGCCGAAGAGGGGTGCTGAGGAGGGTGGCCGGTGGAGGCGGGAGAGGCAGCCGACCCTGGGGGAGATGACGCTTGAGGATTTCCTGGTCAAAGCTGGGGTTGTCACGGATCCGAACGATTTGCCAGGAAACATGGATGTGGTAGGGGGCGCTGCTGCGGCTGCAGCTGGTACGTCTGATTTGAATGCCGGAGCACAGTGGCTACAGCAGTATCACCAGCAGGCTTTGGAGCCCCAGCATCCAAGCATAGGTGCTCCTTACATGGCAACTCACCTGGCACCTCAGCCATTAGCTGTTGCTACAGGTGCTGTTTTGGATCCAATTTACTCCGATGGCCAGATCACTTCGCCAATGCTCGGGGCTCTTTCTGATCCTCAGACACCTGGGCGCAAACGCTGTGCCACAGGGGAGATTGCAGATAAGCTAGTAGAAAGAAGGCAGAAGAGGATGATAAAAAACAGGGAATCAGCTGCCAGGTCAAGAGCGAGGAAGCAGGCTTACACTAATGAGCTTGAAAACAAAGTTCTTCGTCTAGAAGAGGAGAATGAGAGGCTAAAGAAGCAGAAGGAGTTGGATGAGATACTGAACTCCGCGCCTCCCCCGGAACCCAAGTATCAACTCAGGCGAACAAGCTCGGCCGCCTTC
TFome clones do not contain stop codon at 3'end.
translation: miqamashaggsggggggsgrdagsaqrgpmqglarqgslygltlnevqsqlgepllsmnldellksvfpdgadldgggggggiagqsqpalglqrqgsitmppelskktvdevwkgiqdvpkrgaeeggrwrrerqptlgemtledflvkagvvtdpndlpgnmdvvggaaaaaagtsdlnagaqwlqqyhqqalepqhpsigapymathlapqplavatgavldpiysdgqitspmlgalsdpqtpgrkrcatgeiadklverrqkrmiknresaarsrarkqaytnelenkvlrleeenerlkkqkeldeilnsapppepkyqlrrtssaaf