TFome Information for pUT1886

TFome Name pUT1886
Genbank Insert ID HQ858799
Protein Name ZmMYB44
Species Maize
TF Family MYB
Gene ID GRMZM2G111731
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B37 UP 3' Primer Name: B37 DN
5' Primer Tm (º C): 64.7 3' Primer Tm (º C):
5' Primer Sequence: caccATGGCCGCCTTCTTCGCT 3' Primer Sequence: TGC CGC GCC GAC GCC GAG GAA G
PCR Condition: Step 1, 98C 30 sec melt, 1 cycle; Step 2, 98C 10 s
Nucleotide Sequence: ATGGCCGCCTTCTTCGCTGCTGCTCCGCCGCCGGCGGCGGGTGCTCTCGCGTCGTTCCACCACGAGGAGCAGCAGCGTCAGGACGCCGCCGAGGAGCTGTACCACGTGGACGACGACGTCGGCGAGGGCGGCTGCGGCGCAGGACAGCAGGGGAAGCTGTGCGCCAGGGGCCACTGGCGCCCCGCCGAGGACGCCAAGCTCAAGGAGCTCGTCGCGCAGTACGGGCCCCAGAACTGGAACCTCATCGCCGAGAGGCTGGACGGCAGATCAGGGAAGAGCTGCCGCCTGCGGTGGTTCAACCAGCTGGACCCGCGGATCAACCGCCGGGCCTTCTCCGGCGAGGAGGAGGAGCGGCTGCTGGCGGCGCACCGCGCGTACGGCAACAAGTGGGCGCTCATCGCGCGCCTCTTCCCCGGCCGCACCGACAACGCCGTCAAGAACCACTGGCACGTCCTCATGGCGCGCAAGCAGCGGGAGCACACCGGCGCGCTCCGCCGGCGCAAACCCTCGTCCTCGCCGGACCCGGCGCCGCCGACGTCGCACTTGGCGCCCGTCGTCGTCCTCCACCACCACCACCACCAGCACCACGCCGGCTCGCCTCCGCGCACCGTCGCCGCCGCTCACGCGCAGTACACGGCAGCGGACACCCGCGCGCACAGCGGCGGCGAGTCCGACGAGACCGCGTCCACCTGCACCACCGACCTGTCCCTCGGCTCCGCCGCCGCCCCCTGCTTCTACCAGAGTGGCTACGACGCGGCTCCGCGCGCCGCGGCGTTCGCGCCCAGCGCGCGCTCCGCCTTCTCCGCGCCGCCGGCGTCGGCGCGCCATGGCGAGTCACGCTCCGACGACAAGGCGTCGCCGCCCTTCTTCGACTTCCTCGGCGTCGGCGCGGCA
TFome clones do not contain stop codon at 3'end.
translation: MAAFFAAAPPPAAGALASFHHEEQQRQDAAEELYHVDDDVGEGGCGAGQQGKLCARGHWRPAEDAKLKELVAQYGPQNWNLIAERLDGRSGKSCRLRWFNQLDPRINRRAFSGEEEERLLAAHRAYGNKWALIARLFPGRTDNAVKNHWHVLMARKQREHTGALRRRKPSSSPDPAPPTSHLAPVVVLHHHHHQHHAGSPPRTVAAAHAQYTAADTRAHSGGESDETASTCTTDLSLGSAAAPCFYQSGYDAAPRAAAFAPSARSAFSAPPASARHGESRSDDKASPPFFDFLGVGAA