TFome Information for pUT2285

TFome Name pUT2285
Genbank Insert ID KJ726796
Protein Name ZmMYB64
Species Maize
TF Family MYB
Gene ID GRMZM2G124715
transcript T03
Vector pENTR/SD/D-TOPO
Note c.A95G p.H32R in functional domain, not in FlcDNA
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGGGGAGGTCCCCGTGCTGCGAGCAGGCGCACACCAACAAGGGCGCGTGGACCAAGGAGGAGGACCAGCGCCTCATCGCCTACATCAAGGCCCGCGGCGAGGGCTGCTGGAGGTCGCTACCAAAAGCCGCAGGGCTGCTGCGGTGCGGGAAGAGCTGCCGGCTGCGGTGGATCAACTACCTGCGCCCGGACCTCAAGCGCGGCAACTTCAGCGAGGAGGAGGACGAGCTGATCATCAAGTTCCACGAGCTGTTCGGCAACAAGTGGTCGCTCATCGCCGGGAGGCTGCCGGGCAGGACGGACAACGAGATAAAAAACTACTGGAACACGCACATCAAGCGGAAGCTGCTCGCCCGCGGCATGGACCCGCAGACCCACCGCCCGCTGGCCGCAGCGCCAGCAGGAGGGCCGCAGCAGCAGCATTGCCATTACCAGATGGAGCCACAGAAGCGGGCGGCGGCGGCGGACCATTCCGAGGCCGCCGTTGCCACCAACTCGCCGGAGGCCAGCAGCCGCAGCAGCGACGACGACGAGGCGCCGGCGCTGGCGCCACCGCCGCGGCGGCGGCAGCGCCACCTCGACATCGACCTGAACCTGTCCATCAGCCTCGCGGCCTACCAGCCGCCGGAGGGAACCGGCAGCGCCATCGAGCCACTGACGGCGACGACGAAGCGGGAGGAGGGAACGGCGGCGGCGGTGTGCCTCTGCCTCAACAGCCTCGGGTACCGGGCAGGCGTCGAGTGCGCCTGTGGCAGCGGCGGCTCGCCGTCGTCCCGTTCGCAGTGGGCTCGGGATTTTTTACAGGCGGCGCCCTGCTACAGAGGC
TFome clones do not contain stop codon at 3'end.
translation: MGRSPCCEQAHTNKGAWTKEEDQRLIAYIKARGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFSEEEDELIIKFHELFGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLARGMDPQTHRPLAAAPAGGPQQQHCHYQMEPQKRAAAADHSEAAVATNSPEASSRSSDDDEAPALAPPPRRRQRHLDIDLNLSISLAAYQPPEGTGSAIEPLTATTKREEGTAAAVCLCLNSLGYRAGVECACGSGGSPSSRSQWARDFLQAAPCYRG