TFome Information for pUT3148

TFome NamepUT3148
Genbank Insert IDJX469906
Protein NameZmMYB110
Species Maize
TF Family MYB
Gene ID GRMZM2G176327
transcript T01
VectorpENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B279_F 3' Primer Name: B279_R
5' Primer Tm (º C): 68.0 3' Primer Tm (º C):
5' Primer Sequence: caccATGGCGGCGCGTGACCAC 3' Primer Sequence: CAGCCCCATTATCTGCGTGTACCAC
PCR Condition: 30 sec 98°C, 35x(10sec 98°C, 30sec 58°
Nucleotide Sequence: ATGGCGGCGCGTGACCACCGAGAGCTGAGCGGCGACGAGGACTCCGTGGTGGCGGCCGGAGACCTCCGCCGCGGGCCATGGACGGTGGAGGAGGACATGCTCCTCGTCAACTACGTCGCCGCGCACGGCGAGGGCCGCTGGAACGCGCTGGCACGATGCGCAGGTACGCGGTGCTGCATGCTGGTTGCCACGCTACGAGACGACGACCAGACTAATAACACAATGAACTGCGCATATGCAGGGCTCCGGCGGACGGGGAAGAGCTGCCGCCTGCGGTGGCTCAACTACCTGCGGCCGGACCTGCGGCGGGGCAACATCACGGCGCAGGAGCAGCTGCTCATCCTGGAGCTGCACTCCCGCTGGGGCAACCGCTGGTCCAAGATCGCGCAGCACCTCCCGGGGCGCACCGACAACGAGATCAAGAACTACTGGCGCACGCGGGTGCAGAAGCACGCCAGGCAGCTCAACTGCGACGTCAACAGCCAGCGCTTCAAGGACCTCATGCGCTACATCTGGATGCCGCGCCTCCTCGAGCGCATCGGCTCCGACGACTCCGGGGACGGCGCCTTCGTTATCGACGCCGCCACGCCGACGCCAACGCCGACGCTCCTCACGGCCGCCACGTGGTGCGTGGACGACGTCGAGCTGTCCTGCACCACCGCCGTGTCGTCGTCGTCGTCCGTGTCCACGGACAGCATGCACCAGCAGCAGCAGCAGCAGCAGCTCGTCGCCGTGTCCCCGCCGCCACAGCCCGCCGCCTTTGGCGAGAGCAACAACGACGCCTCCCACTACGGTGTCCACAACAGCAACGCTGCTATGTCCATGTGGGGGGACACGCTGTGCCAACCACCGCACTCGGCGACGCCGCACCTGGCGGGCGCCGGGACCTGCAGCTGGTCAGACGAGTCTCTGCTGGTACCTGATGCCGGCGGCGGCGTGTACGCCGACATGGGGCTTCCGGACCTCTGCGACACCGACACCATGTGGGCCGCCGGCGCCAGCGCCGACGACGACCTGTGGTACACGCAGATAATGGGGCTG
TFome clones do not contain stop codon at 3'end.
translation: MAARDHRELSGDEDSVVAAGDLRRGPWTVEEDMLLVNYVAAHGEGRWNALARCAGTRCCMLVATLRDDDQTNNTMNCAYAGLRRTGKSCRLRWLNYLRPDLRRGNITAQEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHARQLNCDVNSQRFKDLMRYIWMPRLLERIGSDDSGDGAFVIDAATPTPTPTLLTAATWCVDDVELSCTTAVSSSSSVSTDSMHQQQQQQQLVAVSPPPQPAAFGESNNDASHYGVHNSNAAMSMWGDTLCQPPHSATPHLAGAGTCSWSDESLLVPDAGGGVYADMGLPDLCDTDTMWAAGASADDDLWYTQIMGL