TFome Information for pUT3152

TFome Name pUT3152
Genbank Insert ID JX469908
Protein Name ZmMYB73
Species Maize
TF Family MYB
Gene ID GRMZM2G121570
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B292_F 3' Primer Name: B292_R
5' Primer Tm (º C): 66.0 3' Primer Tm (º C):
5' Primer Sequence: caccATGTCCAGCGCCCTGCG 3' Primer Sequence: ACGGAACCTGGCCAGGTC
PCR Condition: 40 sec 98°C, 35x(10sec 98°C, 30sec 58°
Nucleotide Sequence: ATGTCCAGCGCCCTGCGCGCCGCCTGGAGCGGGGCTCAGCAGCAGCTGCCGCCCCACGCGGGCGGTGGCATCGGCGGGCATAGGGCGCAGCACCACAAGGGCCCCTGGACCGAGGCGGAGGACGTAGTCCTCAGGGAGATGGTGATGAAGCACGGCGACCGGAAGTGGGCGGTGATAGCGCAGTCGCTCCCCGGCAGGGTGGGCAAGCAGTGCCGCGAGAGATGGACCAACCACCTGCGCCCCGACCTCAAGAAGAGCGTGTGGACTGAAGAAGACGACATGGCGCTGATCAAGGCGCACAAGCGGTGCGGCAACCACTGGTCGACCATCGCCACGTTCCTGCCCGGGCGTTCCGAGAACGCCGTGAAGAACCACTGGAACGCCACCAAGCGGAGCCTCAAGGCCAAGCGCCGGCTGAAGAAGAAGAGCAACGCGCAGCAGGTGCCGGCCGGGCAGTGGTCCGTCCTGGAGGAGTACATCCGCAGCCTGTACCCTGACCTCGCCGACGGCGCCGGCGCCGACCAGACCCCGCCGGCGGCCGAGGACTCCCCCCCGTCGTCCTACAACCTCGGGTCGTACTCGTACGGCGAGGTGATCAGCAGCCCAGCGTCCGCCGCCGCGCCGCCCGGCAGCTTTGACCAGATGACCGCCATGGGGCTGTACCTGGGCGCGTCGTCGTCGTCGCCCGCGCCGGCCGAGCTGCAGGGGGGCATGAGCTCCGACATCGTGGCGCCGTTCCTGCACCTGGACCTCAACGCCTACTACGGCGGCGCGCCGGCGGCGACGATGCGGCTTATGGCTCCGATGGGGGGAATGGCGGCGCCTGTGCCGCAGATGATGGAGCACGATCACTACCAGCACCAGCAGGCTTCCTACGCCACCGCCAACCAGCTGCTCACGTACCCCTTCATCGACAACAGCGTCATGTGGCAGCAGGCGCCGTACGCCGCCCATGGCAGCGCCGCCTACGGCGGTGGCGCCGACGCGGCAGGTGCCGGCCCGAGCAACGTCGTCGCCGTTCCGGCGGACGACGTCGACGTCGTCCAGATGGCCTCCAGGGAGTTCCTGACGCCGTCGGAGGACGAGGTCACCCTGGACCTGGCCAGGTTCCGT
TFome clones do not contain stop codon at 3'end.
translation: MSSALRAAWSGAQQQLPPHAGGGIGGHRAQHHKGPWTEAEDVVLREMVMKHGDRKWAVIAQSLPGRVGKQCRERWTNHLRPDLKKSVWTEEDDMALIKAHKRCGNHWSTIATFLPGRSENAVKNHWNATKRSLKAKRRLKKKSNAQQVPAGQWSVLEEYIRSLYPDLADGAGADQTPPAAEDSPPSSYNLGSYSYGEVISSPASAAAPPGSFDQMTAMGLYLGASSSSPAPAELQGGMSSDIVAPFLHLDLNAYYGGAPAATMRLMAPMGGMAAPVPQMMEHDHYQHQQASYATANQLLTYPFIDNSVMWQQAPYAAHGSAAYGGGADAAGAGPSNVVAVPADDVDVVQMASREFLTPSEDEVTLDLARFR