TFome Information for pUT3155

TFome Name pUT3155
Template BT062722.1
Genbank Insert ID JX469910
Protein Name ZmMYB81
Species Maize
TF Family MYB
Gene ID GRMZM2G020772
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B311_F 3' Primer Name: B311_R
5' Primer Tm (º C): 69.1 3' Primer Tm (º C):
5' Primer Sequence: caccATGATGCGGGAGACGTACATGG 3' Primer Sequence: AAACAGAACGCTGTGGTGGCTG
PCR Condition: 5 l GC buffer (NEB) 1 l primer forward 20mM 1 l pr
Nucleotide Sequence: ATGATGCGGGAGACGTACATGGACGTGCTGCCGCCGGTGGACCACATAGCCGCCTCACGGAGCGGCGGCTGGTTCCCGGGCGCGGCGCGTCTCTGGACGGCGGCGGAGAACAAGCAGTTCGAGCGGGCGCTGGCCGGGCTCGACCTCTGCCGCCCGGACTGGGAGAAGGTGGCGCGGGCCATCCCGGGCCGGACGGTGCGCGAGGTCGTCAGCCACTTCAAGAGCCTCCAGGTCGACGTCCAGCAGATCGAGAGCGGCCTGGTGCCCATGCCGGTCTACGGCGCCGGGGCCGGCTCGTTCACCCTGCAGTGGGACGGCTGCTACGGCCCCGCGGACTCGAGGCACAACGGCTACCGCTTCGGAAGCGGAGGCTGCGGGAGGCGGCACCACGGCCGCACCCCGGAGCAGGACCGGAAGAAGGGCGTGCCGTGGACGGAGGAGGAGCACAGGCTGTTCCTCTTAGGCCTGAAGAAATACGGCAAGGGGGACTGGAGGAACATATCGCGCAACTACGTCCAGACGCGGACGCCCACGCAGGTGGCCAGCCACGCGCAGAAGTACTTCATCAGGCTCAACTCCGGCGGCAAGGACAAGAGGAGGTCCAGCATCCACGACATCACCACGGTGAACCTGACGGACGACGAGCGGGCGCCCTCGCCGTCGCGGTCCTCTCTGATCACCACCACCAGCCAGCCAAACGCGCCGGCTCCGGCCGCAGCGGTGATAGGCGGGCCCTTCTCGTCGGCGGCGGCGGCCGAGGCCAAGCAGCACCAGCACGGCGCTGGGAACCTGCCACCGAACCGGACCTCCGTGGTGCCGGCTGTTTACAGGATGGACGATTCGCAGGACCACGGCCTGCAGTGTGGCCCTCTGCGTCATCAACTGGTCGCCAGCCACCACAGCGTTCTGTTT
TFome clones do not contain stop codon at 3'end.
translation: MMRETYMDVLPPVDHIAASRSGGWFPGAARLWTAAENKQFERALAGLDLCRPDWEKVARAIPGRTVREVVSHFKSLQVDVQQIESGLVPMPVYGAGAGSFTLQWDGCYGPADSRHNGYRFGSGGCGRRHHGRTPEQDRKKGVPWTEEEHRLFLLGLKKYGKGDWRNISRNYVQTRTPTQVASHAQKYFIRLNSGGKDKRRSSIHDITTVNLTDDERAPSPSRSSLITTTSQPNAPAPAAAVIGGPFSSAAAAEAKQHQHGAGNLPPNRTSVVPAVYRMDDSQDHGLQCGPLRHQLVASHHSVLF