TFome Information for pUT3206

TFome Name pUT3206
Genbank Insert ID JX469945
Protein Name ZmMYB106
Species Maize
TF Family MYB
Gene ID GRMZM2G048910
transcript T01
Vector pENTR/SD/D-TOPO
Note c.C557T p.P186L Not in functional domain. Not in template FlcDNA.
Request Information: Deposited to ABRC
5' Primer Name: C154_F 3' Primer Name: C154_R
5' Primer Tm (º C): 73.5 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGGAGGCAGCCGTGCT 3' Primer Sequence: TATTCTGTGGTCGTCTTCTTGGTCGAA
PCR Condition: PCR Reaction Mix: 5 l GC buffer (NEB) 1 l primer f
Nucleotide Sequence: ATGGGGAGGCAGCCGTGCTGCGACAAGGTTGGCGTGAAGAAGGGCCCGTGGACGGCGGAGGAGGACCAGAAGCTCGTCGGCTTCCTCCTCACCCACGGTCACTGCTGCTGGCGCGTCGTCCCCAAGCTCGCAGGGTTGCTGAGGTGCGGGAAGAGCTGCAGGCTGCGGTGGACCAACTACCTGAGGCCGGACCTCAAGAGGGGCCTGCTCTCCGACGACGAGGAGAGGCTCGTCATCGACCTGCACGCGCAGCTCGGGAACAGGTGGTCCAAGATCGCGGCGCAGCTACCGGGCAGGACGGACAACGAGATCAAGAACCACTGGAACACACACATCCGCAAGAAGCTCGTCCGGATGGGGATCGACCCCGTCACCCACCTGCCGTTGCAGGAACCGCCGGCTCCTGCTCCTGCTCCCGCCGAGCAGCAGGAGCAGAGCCACAGGCAGCAAGAAGAACTGCAACTGCAAGAGCTGCAGAACGGCCGCGAGCTTATCATGCAGGAGGGCGCGGGGGAAGACGATATCACGCCGATGATCCAGCCGCACGAGATCATGCTGACGGCGGCAGCGGCAAGCAACTGCGGCTCTGTTTCCTCTGCCCACGCCGGCTCCGCGTCCGTGGTCTCGCCGTCCTGCTCCTCCTCGGCGGTGTCCGGCGTGGAGTGGCCGGAGCCCATGTACCTGCTCGGCATGGATGGCATCATGGACGCCGACTGGGGCAGCCTCTTCCCCGACACTGGCGCTGGCGGCGGCGGCGGCGGCTTCGACTTGGGCGTCGATCCGTTCGACCAGTACCCGGGCGGTGGCTTCGACCAAGAAGACGACCACAGAATA
TFome clones do not contain stop codon at 3'end.
translation: MGRQPCCDKVGVKKGPWTAEEDQKLVGFLLTHGHCCWRVVPKLAGLLRCGKSCRLRWTNYLRPDLKRGLLSDDEERLVIDLHAQLGNRWSKIAAQLPGRTDNEIKNHWNTHIRKKLVRMGIDPVTHLPLQEPPAPAPAPAEQQEQSHRQQEELQLQELQNGRELIMQEGAGEDDITPMIQPHEIMLTAAAASNCGSVSSAHAGSASVVSPSCSSSAVSGVEWPEPMYLLGMDGIMDADWGSLFPDTGAGGGGGGFDLGVDPFDQYPGGGFDQEDDHRI