TFome Information for pUT3445

TFome Name pUT3445
Genbank Insert ID KJ726900
Protein Name ZmMYB89
Species Maize
TF Family MYB
Gene ID GRMZM2G040924
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B297_F 3' Primer Name: B297_R
5' Primer Tm (º C): 76.8 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGGAGGGCGCCGTGCTGC 3' Primer Sequence: CTTGAACGCCGTGTCCAGG
PCR Condition: 5 l GC buffer (NEB) 1 l primer forward 20mM 1 l pr
Nucleotide Sequence: ATGGGGAGGGCGCCGTGCTGCGACAGGACCAAGGGCCTCAAGAAGGGGCCCTGGACGCCGGAGGAGGACAAGCTCCTCGTCGACTACATCCAGACCAACGGCCATGGCAGCTGGCGCCTGCTCCCCAAGCTCGCAGGGCTAAACCGGTGCGGCAAGAGCTGCCGACTGCGGTGGACGAACTACCTCCGGCCGGACATCAAGCGCGGGCCCTTCACATCCGAGGAGCAGAAGTCCATCGTCCAGCTCCACGCCATCGTCGGCAACAAGTGGTCCATGATCGCGGCGCAGCTCCCTGGCCGGACGGACAACGAGATCAAGAACTACTGGAACACGCACCTCAAGAAGCAGCTGCGTCGGATGGGCCTCGACGAGCCCCCGCCCGGCCCGGCCGCCGGCTGCCCCTCCGCGCGCCACATGGCGCAGTGGGAAACGGCCAGGCTCGAGGCGGAGGCGCGCCTCTCCCTCCTCGCCACCGCCGCCTCCTCCTCCTCCTGCGGCGCCATCGCGGCCACCTCCGCCTCATCCTCCTCCTCCACCGTGGACTTGAAGACCGCATGCGCCAGGCCCGCGGACATCTTCCTGCGCCTGTGGAGCTCGGACATCGGGGACTCCTTCCGCCGCAAGACGGCCGCGGCGCCCGTGGTCAAGAGGAAGGACGCGGTGATCAAGCAGGAGTCGCAGGCGCTGCTGCTGGGTCCCGGGGACGACTCCTCGGCCGCGTCCAACGAGACGGAGGTGGCGGAGGCGCTGGAGGAGTACCAGATGTTCCTCGACTTCGCCGGCGAAGAGCTGGGGCTGTTTCACGGCCGGCACGGCGGCTTCTCGCTGTTCCCGCCGCTCGACGTGCTCGCCGAGGCGTCCCTGGACACGGCGTTCAAG
TFome clones do not contain stop codon at 3'end.
translation: MGRAPCCDRTKGLKKGPWTPEEDKLLVDYIQTNGHGSWRLLPKLAGLNRCGKSCRLRWTNYLRPDIKRGPFTSEEQKSIVQLHAIVGNKWSMIAAQLPGRTDNEIKNYWNTHLKKQLRRMGLDEPPPGPAAGCPSARHMAQWETARLEAEARLSLLATAASSSSCGAIAATSASSSSSTVDLKTACARPADIFLRLWSSDIGDSFRRKTAAAPVVKRKDAVIKQESQALLLGPGDDSSAASNETEVAEALEEYQMFLDFAGEELGLFHGRHGGFSLFPPLDVLAEASLDTAFK