TFome Information for pUT4963

TFome Name pUT4963
Template Synthesized template
Genbank Insert ID KJ727406
Protein Name ZmMYB122
Species Maize
TF Family MYB
Gene ID GRMZM2G416652
transcript T02
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGACCGTGGTTGAGGCTGGCGAGGTGCTGAATCTTAAGGTTGGCGAGAACCCACTGCTTGAGGGCGAAGCTAAGACTGGCTACGTGAGCCCAGATGACCAAGATGGCGAGACTGCATCTGAGAAGCCATGCGGTGCTCCACAATTGAAGAAGGGACCTTGGTCCCCAGACGAGGACAAGCTGCTGAAGAATTACGTTGAGGCACACGGCGAGGGCAAGTGGAACAAGGTTCAGAGGAACTCTGGCCTGAACAGGTGCGGTAAGTCTTGCAGGCTTAGGTGGACCAACCACCTGAGGCCAGATCTCAAGAAGGGCCCGTTCGACAACGAGGAAATCGACAAGATCCTGAAGTTCTACCTGAAGTGGGGCCCGAAGTGGGCTAAGATCGCTTCTAGACTTCCAGGCAGGACCGATAACGAGATCAAGAACTTCTGGAACACCCGCATCAAGAAGACCGAGAAGCAGGGCCTTCCAATCTACCCAGAGCATGTGCTGTCTCAGGTGAAGCAGCCACAGCAGGACATGAACTGCGAGACTCCAGGCCTTTCTCACGGCAAGAAGAGGATCAGAGAGATCGAGATCCACGACCTGATGGACGTGAAGATCCTTTTCCAGCACCTGGACTACCACAAGGATCTGGTGGTGCCAACTAAGCCACTTAAGAGGCGCGCTTCTATCGGCAGCCTGAAGATCTCTGGGGAGACTAAGGAAACCTACTGCAGCACCGACCTGAACTACGTGTTGGCTAGGTCTGAGTCTGTGCCAACCGGCAGCGCTATTGCTTCTGGTTACCCAGTTGAGCTGCCGAGCATCCAGTCATCTAGCAGCACCCTGTCTAACGATTGGCTGCTCCAATGCGTGAGCGCTTCTGTTGAGCAGCAGATCCACAGCTCTATCCAGTCCACCGAGACTATCAGCTCTCAGACTACTGGCCTGCTGCACACCATGAGCGAGATCTCATTCGAGACTCTCATCCCGATGGTGTACCCGATGATCCACTCTTTCGGCTACAGCGAGCATGAGAGCAGCCCAAACACTGACATCCAGGCTGCTAACCTGAGCCTGGGCTCTGATGATGTGAGCCAGTACTACCAGGTGGCCAGCTTCTTCGATCCAGGCGTTCCAGATACTGAGCTGGGCGCTTCTTTCTTCAACGACACTCCTCCAGAGACTAGCTTCCTGAACCAGCAAAAGCAAGTGAGC
TFome clones do not contain stop codon at 3'end.
translation: MTVVEAGEVLNLKVGENPLLEGEAKTGYVSPDDQDGETASEKPCGAPQLKKGPWSPDEDKLLKNYVEAHGEGKWNKVQRNSGLNRCGKSCRLRWTNHLRPDLKKGPFDNEEIDKILKFYLKWGPKWAKIASRLPGRTDNEIKNFWNTRIKKTEKQGLPIYPEHVLSQVKQPQQDMNCETPGLSHGKKRIREIEIHDLMDVKILFQHLDYHKDLVVPTKPLKRRASIGSLKISGETKETYCSTDLNYVLARSESVPTGSAIASGYPVELPSIQSSSSTLSNDWLLQCVSASVEQQIHSSIQSTETISSQTTGLLHTMSEISFETLIPMVYPMIHSFGYSEHESSPNTDIQAANLSLGSDDVSQYYQVASFFDPGVPDTELGASFFNDTPPETSFLNQQKQVS