TFome Information for pUT5352

TFome Name pUT5352
Template BT033269.1
Genbank Insert ID KJ727493
Protein Name ZmbZIP123
Species Maize
TF Family bZIP
Gene ID GRMZM2G002075
transcript T01
Vector pENTR/D-TOPO
Note c.G571A p.E191K not present in template FlcDNA. (not in functional domain)
Request Information: Deposited to ABRC
5' Primer Name: B446_F 3' Primer Name: B446_R
5' Primer Tm (º C): 75.0 3' Primer Tm (º C):
5' Primer Sequence: caccATGGACGAGCTGCTCCG 3' Primer Sequence: CCAGGGGGCCGTCAACG
PCR Condition: 40 sec 98°C 30x : 15 sec 98°C 30 sec 58&de
Nucleotide Sequence: ATGGACGAGCTGCTCCGGAGCATCTGGACCGCAGAGGAGACCCAGGCCAAGGCCTCCGCCTCTATCGCAGGAGCGAGCGCGGGGATGCCCCCCACGCCGATGCAGCGGCAGGGATCGTCGCTCACACTGCCCCGCATGCTCAGCACCAAGACGGTCGACGAGGCGTGGAGAAATCTCGTGCGCGACGAACCGCCGCAGGGGGCGGACGGCGGCGGACACCAGCCGCCCCACCGCCAGTCAACGCTCGGGGAGATGACTCTGGAGGAGTTCTTGGTCAGAGCTGGCGCGGTCAAGGAGAACCCCGCTTCTGCTCCTCCAGCGCCGCCACCCATGGTGCCGCCGCGGCCGGTACCTGTTGCCCCTAAAAGCTCCGCCTTTTTTGGGGATTTACCGGGTGCCGACGACGACGCAGCTACGGCAGCGGTAGGGTTTGCACCGGTCGGCATGGTGGATCTGGCCCTGATACCGCCCAGGGCGGCAGGCATGGGAGGCAGCGCCATGGCTGTGCAAACAGCGGTGAGCCAGCTTGATTCTGTCGGGAAGGGATACAGCGACCTGTCGTCGCTGACGAAGCCGCAAACTTTTTCGTTTGAAAGAATGATTCGGGGGAGAAGGCATGGAGGCGGAGTGGAGAAAGTGGTGGAGAGGCGGCGGCGGAGGATGATCAAGAACAGGGAGTCCGCCGCGAGGTCCCGAGCGCGCAAACAGGCTTATACAATGGAGTTAGAAGCCGAAGTTCAGAAACTCAGAGAGCAGAATCAGGAACTGGAGAGGAAACAGGCAGAAATTATGGAAATGCAGAACAACGAGGTATCAGAAATGTTGAAGGATCCATTCGGACGGAAGAAACGGCTGTGCTTGCGAAGAACGTTGACGGCCCCCTGG
TFome clones do not contain stop codon at 3'end.
translation: MDELLRSIWTAEETQAKASASIAGASAGMPPTPMQRQGSSLTLPRMLSTKTVDEAWRNLVRDEPPQGADGGGHQPPHRQSTLGEMTLEEFLVRAGAVKENPASAPPAPPPMVPPRPVPVAPKSSAFFGDLPGADDDAATAAVGFAPVGMVDLALIPPRAAGMGGSAMAVQTAVSQLDSVGKGYSDLSSLTKPQTFSFERMIRGRRHGGGVEKVVERRRRRMIKNRESAARSRARKQAYTMELEAEVQKLREQNQELERKQAEIMEMQNNEVSEMLKDPFGRKKRLCLRRTLTAPW