TFome Information for pUT5353

TFome Name pUT5353
Template BT063597.1
Genbank Insert ID KJ727494
Protein Name ZmMYB99
Species Maize
TF Family MYB
Gene ID GRMZM2G175232
transcript T01
Vector pENTR/D-TOPO
Note . c.C36T p.G12(=) c.G840A p.G240(=) c.G850A p.A284T Not present in template FlcDNA. Not in functional domain.
Request Information: Deposited to ABRC
5' Primer Name: C148_F 3' Primer Name: C148_R
5' Primer Tm (º C): 76.0 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGACGGCTCTCCTGC 3' Primer Sequence: GAAGTATTCCAAGCCGAAGTCGAG
PCR Condition: PCR Reaction Mix: 5 l GC buffer (NEB) 1 l primer f
Nucleotide Sequence: ATGGGACGGCTCTCCTGCGGCGGCGGTGGCGGCGGTGGCGTGCAGCCCAAGCTCCGCAAGGGGCTCTGGTCGCCCGAGGAAGACGAGAAGCTGTACAATCACATCATCCGACACGGCGTCGGCTGCTGGAGCACTGTCCCCAAGCTCGCAGGGCTGCAGCGCTGCGGCAAGAGCTGCCGCCTGCGGTGGATCAACTACCTCCGCCCCGACCTCAAGCGCGGCAGCTTCTCGCAGCAGGAGGAGGACCTCATCGTCGCGCTCCACGAGATCCTGGGGAACAGGTGGTCGCAGATCGCGTCGCACTTGCCGGGGCGGACGGACAACGAGATCAAGAACTTCTGGAACAGCTGCCTGAAGAAGAAGCTCCGGCAGCGCGGCATCGACCCGGCCACGCACAAGCCAGTCGCCGCGGCGGAGGCGAGCGCGGCGCTGCCGGACGCTCGAGACCACGACCGTGAGCCCGGAGGAGCCGGCGCCGGCGCCGACGCCGACGGCCTGGCGCAGCAGAGCAAGCAGCCGGCGGCGGCCGTGTTCGACCCGTTCCCTGTGGTCGACTTCGGCTTCGACCTGAGCGGCGGCGGCGGCGTGGCGGCATTGTACGGCGGCCCGTACGACGCCGCCGCCGGCAAGGCGTCGGCGGACGACGGCGGGTTCGTGGCCGACTACAGCAGCGTGCTGGACGTGTCGGAGAACCTGGGATACGGGGAGAGCTCCAGCAACAGCAGCAACTGGGGGAACGGCGCGGAGATGGGCAATGCCGCCGCCGCCGTGCTCGACGGCGAGGTGCTGCACTGGGCCAAGCCGGAGCCGTACACGGAGCTGGAGCAGCGGAGCGCGGGACAAGCCGCCACGGACGACGACGCGCTGCATCATAGGTTCTTGCTGCCCTGCGGCCAGGAGCAGAGCCTGGCGCATCTCGACTTCGGCTTGGAATACTTC
TFome clones do not contain stop codon at 3'end.
translation: MGRLSCGGGGGGGVQPKLRKGLWSPEEDEKLYNHIIRHGVGCWSTVPKLAGLQRCGKSCRLRWINYLRPDLKRGSFSQQEEDLIVALHEILGNRWSQIASHLPGRTDNEIKNFWNSCLKKKLRQRGIDPATHKPVAAAEASAALPDARDHDREPGGAGAGADADGLAQQSKQPAAAVFDPFPVVDFGFDLSGGGGVAALYGGPYDAAAGKASADDGGFVADYSSVLDVSENLGYGESSSNSSNWGNGAEMGNAAAAVLDGEVLHWAKPEPYTELEQRSAGQAATDDDALHHRFLLPCGQEQSLAHLDFGLEYF