TFome Information for pUT5356

TFome Name pUT5356
Template BT038667
Genbank Insert ID KJ727497
Protein Name ZmMYB130
Species Maize
TF Family MYB
Gene ID GRMZM2G069325
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B306_F 3' Primer Name: B306_R
5' Primer Tm (º C): 70.4 3' Primer Tm (º C):
5' Primer Sequence: ccacATGGCGGCCAGTAGCAGCGGAGC 3' Primer Sequence: CGTCAGCCTGTTGCAGAGACCC
PCR Condition: PCR Reaction Mix:5 l GC buffer (NEB) 1 l primer fo
Nucleotide Sequence: ATGGCGGCCAGTAGCAGCGGAGCAGCCTTCGCGGCGCCCGCCACGCCGGCGCTCTCGCCCGCCTCCTCGTGCGTCACCAGCTCCTCCAGCGGCGACGTGCGCCTCGGCGCAGCGTACACGGAGCCGCCGCCGCCTCGGCAGCACGCGGGGCTCGTACGCTCTGACGCTCCGCGGACGGAGCTCGCGCCCGTGCCGGCAGTCGCGCACCTGGACGGCGCCTGCTGGCCGGCCGCGGCGGCGCTGGACGTGCTCCTGCCCGAGCTCGGCGGCGAGCAGCTGTTCCCGTACGGGTACGGCGACTTCTTCGGCGGGCTGCAGGACAGGGCCCTGGAGCAGCAGCTCTCGTCGTGCTACTTCCCCAACGTGGCCGAGATATGGGGCGCCGCTGCCGTCGCCCCCGACGGCAAGCCGCCGGGTCTCTGCAACAGGCTGACG
TFome clones do not contain stop codon at 3'end.
translation: MAASSSGAAFAAPATPALSPASSCVTSSSSGDVRLGAAYTEPPPPRQHAGLVRSDAPRTELAPVPAVAHLDGACWPAAAALDVLLPELGGEQLFPYGYGDFFGGLQDRALEQQLSSCYFPNVAEIWGAAAVAPDGKPPGLCNRLT