TFome Information for pUT5365

TFome Name pUT5365
Genbank Insert ID KJ727506
Protein Name ZmMYB93
Species Maize
TF Family MYB
Gene ID GRMZM2G093660
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: C150_F 3' Primer Name: C150_R
5' Primer Tm (º C): 65.5 3' Primer Tm (º C):
5' Primer Sequence: caccATGGAGGGCGGCGATGG 3' Primer Sequence: GTCCTGGCCGTTCGCGGCACTACC
PCR Condition: PCR Reaction Mix: 5 l GC buffer (NEB) 1 l primer f
Nucleotide Sequence: ATGGAGGGCGGCGATGGCTGCGGCTCCTCGGCGGCGGCGTCGGGGTCCGGGAGGGTGACGCGGCGGTGGACGCCGGAGGAGGACGACCTGCTGCGGCGCGCGGTCGCGCGGCACGGGCCGCGGAAGTGGCCCGAGCTCAGCGTCGATATCCCCGGTCGGTCCGGAAGGTCGTGCCACCGGCGGTGGGTCCAGCATCTCAGCCCCGGCCTGGAGCGTCGCGCCTTCACGCCCGAGGAGGACGCCGTCATCGTCGCGGCGCAAGCGATGTACGGCAACAAGTGGACCACCATCGCGCGGATGCTCCCCGGCCGCACCCGCACCGATATCTCCATCAAGAACCGCTGGAACTCCGCGCTGCAACAACATTGCAGGGCGGCGACCGCCAGCGCCAACACCGCCGGGTGCGCCCTCCCACTGCGGCCGGCGACCACGGCCCCCGTGCCGATTCCCGATCTCATGTATCTCAACAAGAAGTTGGCGGCGGCTGAGGCATCCCTTCCGTTCCCTCGTCTGGAGCCAAAGGACGACGAGGACGACGAGGACATGGACGAGACGGGCGAGGACGAGGACATGAACGAGCTGGGGGACGACGGCAGCAGCGAGGTCTTCCCGCCCGTGCCGGCGGTGCCGCTCACGCTAACCCTCAGCCTCTCTTCCGGCGTCCACGGCACCCTCGCATCGCAGAGCACCTTCGCATCTGCGGCGACCCTCGCATCGGCGGCTACCCTCGCATCGCAGAGCACCCTCGCATCGCAGAGCACCTTCGCATCGGCGGCGGCGACAGCGGGGAGTGCCATGACAATGAGGTCGAATCTTGGGCAGGATCCGTGGTTGGTGCCTGCGTTGCGGCTGATTGTTAGCGATGAGGTGCAGCGGAAGATGCAGGAGATGCCGCAGGTCACGGCTCCGGCCAGCAGGAGCAGCGCCGATGCTGCCGACGGTAGTGCCGCGAACGGCCAGGAC
TFome clones do not contain stop codon at 3'end.
translation: MEGGDGCGSSAAASGSGRVTRRWTPEEDDLLRRAVARHGPRKWPELSVDIPGRSGRSCHRRWVQHLSPGLERRAFTPEEDAVIVAAQAMYGNKWTTIARMLPGRTRTDISIKNRWNSALQQHCRAATASANTAGCALPLRPATTAPVPIPDLMYLNKKLAAAEASLPFPRLEPKDDEDDEDMDETGEDEDMNELGDDGSSEVFPPVPAVPLTLTLSLSSGVHGTLASQSTFASAATLASAATLASQSTLASQSTFASAAATAGSAMTMRSNLGQDPWLVPALRLIVSDEVQRKMQEMPQVTAPASRSSADAADGSAANGQD