TFome Information for pUT5383

TFome Name pUT5383
Genbank Insert ID KJ727524
Protein Name ZmMYB127
Species Maize
TF Family MYB
Gene ID GRMZM2G369799
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: SE0083_F 3' Primer Name: SE0083_R
5' Primer Tm (º C): 60.5 3' Primer Tm (º C):
5' Primer Sequence: caccATGATGAAGAACTACCCTGGTCC 3' Primer Sequence: ACGGTGGTGTCCCTTGGCTC
PCR Condition: Step 1, 98°C 3 min melt, 1 cycle; Step 2, 98&d
Nucleotide Sequence: ATGATGAAGAACTACCCTGGTCCTGCTAGCAGCAGTAGTGTTGCTGTAGAGGTGAAGAAGGGGTCATGGAGCCCCGAGGAGGACGCCCTGCTGACCAGGCTGGTGGAGCAGCACGGGCCCCACCGCTGGAGCCTCATCAGCGCCCCAATCCCTGGCCGCTCCGGCAAGTCCTGCCGACTCCGCTGGTGCAACCAGCTCAGCCCCGACGTGCACCACCGCCCTTTCACGCCGCACGAGGACGCGCTCATCCTCGCCGCTCACGCCCGCTACGGCAACAAGTGGGCCACCATCGCGCGCCTCCTTCCCGGCCGCACCGACAACTCCATCAAGAACCACTGGAACTCCAACCTCCGGAGGTGCAGGCGCCGAGCGGCGGCGGCGGCGGTGGCCTCCCGACCGCAGGTGCAGGACAGCGACGACGCTCCTGCTGCTGCTGCTGCTCATGATGATCAGCCGGCGGCTGTGGTTGCTGCTGGTGGTTTAGGTGGTGGCAACAGCAGCAGCGGTCTGCCGCCTGCAGCAGCAGGGGCCGCAACTGCCGAGGCCGAGCCGTCTCTGTCCCTCAGCCTTGGCCTCCCGCTGCCAGCAGCAGAACCAGCTGAAGCCGCGGCTGACGACGAGAGCCGCAACAGCCAGGGCCAGGCATCGCCGTTACTGGAGGAAGGAGAAGGAAACGCGCAGCTGTTGGCAGTGGTGCGCCGGATGGTCAGGGAGGAGGTGCAACGCCAGACGGGACAGCTCGCCTACTCGCTCATGGCCGCAGCAGCAGCCAGAGCCAAGGGACACCACCGT
TFome clones do not contain stop codon at 3'end.
translation: MMKNYPGPASSSSVAVEVKKGSWSPEEDALLTRLVEQHGPHRWSLISAPIPGRSGKSCRLRWCNQLSPDVHHRPFTPHEDALILAAHARYGNKWATIARLLPGRTDNSIKNHWNSNLRRCRRRAAAAAVASRPQVQDSDDAPAAAAAHDDQPAAVVAAGGLGGGNSSSGLPPAAAGAATAEAEPSLSLSLGLPLPAAEPAEAAADDESRNSQGQASPLLEEGEGNAQLLAVVRRMVREEVQRQTGQLAYSLMAAAAARAKGHHR